Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5FD13

Protein Details
Accession A0A5J5FD13    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-77LLRTGKCRRRPLLTKYPRPAFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 4, plas 4, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MLHLIFLFTAARTITVPAVLANAPGILEHPFTGASRRIFRCLSATGTIFGPYRAGSLLRTGKCRRRPLLTKYPRPAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.09
6 0.08
7 0.08
8 0.07
9 0.06
10 0.06
11 0.05
12 0.06
13 0.05
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.1
20 0.13
21 0.15
22 0.21
23 0.22
24 0.25
25 0.25
26 0.25
27 0.25
28 0.23
29 0.23
30 0.19
31 0.19
32 0.17
33 0.17
34 0.18
35 0.15
36 0.13
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.14
44 0.22
45 0.24
46 0.32
47 0.39
48 0.47
49 0.56
50 0.65
51 0.64
52 0.66
53 0.72
54 0.74
55 0.78
56 0.8
57 0.82