Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F638

Protein Details
Accession A0A5J5F638   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-62QHLRNPSKLAKNTKKDKRVISKARVHydrophilic
72-95KKALDEKKSMSRRRRKTQPAAPAAHydrophilic
NLS Segment(s)
PositionSequence
47-88AKNTKKDKRVISKARVITGAQAMEGKKALDEKKSMSRRRRKT
Subcellular Location(s) cyto 2.5, cyto_nucl 13, nucl 22.5
Family & Domain DBs
Amino Acid Sequences MEWIKTATYGQLCKHVLRLNNELVSEKVQNEILTNDMQHLRNPSKLAKNTKKDKRVISKARVITGAQAMEGKKALDEKKSMSRRRRKTQPAAPAAPNAPDALPAVPATPRQTKVCFVSPVLPVETPRCPVNRSRQKATPPPDDWSDSSSDEETPVTPLGLTRPPRPPVVLNTPLAPNRRLPDRPLAVNLRSRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.39
4 0.42
5 0.46
6 0.44
7 0.44
8 0.44
9 0.4
10 0.36
11 0.34
12 0.3
13 0.24
14 0.2
15 0.18
16 0.18
17 0.17
18 0.16
19 0.15
20 0.14
21 0.13
22 0.15
23 0.18
24 0.18
25 0.2
26 0.26
27 0.26
28 0.28
29 0.31
30 0.34
31 0.39
32 0.45
33 0.54
34 0.57
35 0.65
36 0.72
37 0.79
38 0.81
39 0.79
40 0.81
41 0.8
42 0.81
43 0.81
44 0.78
45 0.76
46 0.71
47 0.66
48 0.59
49 0.48
50 0.4
51 0.33
52 0.25
53 0.17
54 0.16
55 0.14
56 0.13
57 0.13
58 0.11
59 0.09
60 0.13
61 0.15
62 0.15
63 0.16
64 0.19
65 0.29
66 0.38
67 0.46
68 0.51
69 0.6
70 0.67
71 0.75
72 0.81
73 0.81
74 0.82
75 0.82
76 0.81
77 0.79
78 0.74
79 0.65
80 0.57
81 0.48
82 0.39
83 0.32
84 0.22
85 0.14
86 0.1
87 0.09
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.08
94 0.11
95 0.14
96 0.17
97 0.19
98 0.21
99 0.23
100 0.26
101 0.29
102 0.27
103 0.25
104 0.27
105 0.26
106 0.26
107 0.25
108 0.21
109 0.18
110 0.19
111 0.2
112 0.17
113 0.18
114 0.18
115 0.18
116 0.24
117 0.34
118 0.41
119 0.47
120 0.51
121 0.56
122 0.62
123 0.69
124 0.71
125 0.69
126 0.61
127 0.58
128 0.56
129 0.53
130 0.46
131 0.4
132 0.35
133 0.27
134 0.27
135 0.23
136 0.2
137 0.17
138 0.16
139 0.14
140 0.13
141 0.12
142 0.09
143 0.08
144 0.09
145 0.11
146 0.18
147 0.21
148 0.25
149 0.33
150 0.35
151 0.38
152 0.41
153 0.41
154 0.42
155 0.47
156 0.47
157 0.42
158 0.41
159 0.45
160 0.46
161 0.46
162 0.4
163 0.36
164 0.35
165 0.42
166 0.42
167 0.41
168 0.47
169 0.49
170 0.52
171 0.54
172 0.56
173 0.53
174 0.58