Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F5F3

Protein Details
Accession A0A5J5F5F3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
150-171AGHLRHRKSRDWRTTLQTPRRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, pero 7, cyto_mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR039544  Tim44-like  
IPR007379  Tim44-like_dom  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF04280  Tim44  
Amino Acid Sequences MAANLSEAGGAQASEQAAILLTAWRGFFAVNETAMVIRKMPEIDPNVQLEPFMREVLDAYVKDDVKTLKSWLSDARHSVHAALTKQYTTNVLMSDGKILDIRNVDVLQARYPGPGRYPSIHRDMQGQQRIRAPRSEDEGAQGWHGIQGAAGHLRHRKSRDWRTTLQTPRRTERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.07
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.08
13 0.08
14 0.08
15 0.11
16 0.12
17 0.11
18 0.11
19 0.12
20 0.12
21 0.14
22 0.14
23 0.1
24 0.09
25 0.1
26 0.11
27 0.12
28 0.17
29 0.2
30 0.23
31 0.25
32 0.27
33 0.27
34 0.25
35 0.25
36 0.2
37 0.18
38 0.16
39 0.13
40 0.1
41 0.09
42 0.1
43 0.11
44 0.14
45 0.11
46 0.11
47 0.15
48 0.15
49 0.15
50 0.16
51 0.16
52 0.14
53 0.16
54 0.16
55 0.14
56 0.14
57 0.16
58 0.19
59 0.22
60 0.22
61 0.23
62 0.25
63 0.24
64 0.24
65 0.23
66 0.19
67 0.18
68 0.17
69 0.17
70 0.15
71 0.13
72 0.13
73 0.13
74 0.13
75 0.11
76 0.11
77 0.09
78 0.1
79 0.1
80 0.1
81 0.11
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.11
93 0.12
94 0.11
95 0.12
96 0.12
97 0.12
98 0.13
99 0.14
100 0.13
101 0.16
102 0.19
103 0.21
104 0.25
105 0.27
106 0.32
107 0.34
108 0.32
109 0.34
110 0.37
111 0.43
112 0.46
113 0.46
114 0.43
115 0.47
116 0.52
117 0.48
118 0.47
119 0.42
120 0.38
121 0.42
122 0.41
123 0.35
124 0.33
125 0.34
126 0.3
127 0.26
128 0.22
129 0.15
130 0.14
131 0.13
132 0.09
133 0.07
134 0.06
135 0.08
136 0.12
137 0.12
138 0.16
139 0.21
140 0.25
141 0.32
142 0.36
143 0.43
144 0.5
145 0.6
146 0.67
147 0.69
148 0.73
149 0.74
150 0.8
151 0.82
152 0.81
153 0.79
154 0.76