Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5ELJ9

Protein Details
Accession A0A5J5ELJ9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-90SDTRKAKRKAKVKAWRKAWRKDNRKKDRQREKKVTGETBasic
NLS Segment(s)
PositionSequence
56-85RKAKRKAKVKAWRKAWRKDNRKKDRQREKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAESSSMAESSSMAESRSIQGRARANGAASAAPAAKAETPQATVLSPPTIPASDTRKAKRKAKVKAWRKAWRKDNRKKDRQREKKVTGETAVTPAPASVRQKSGSIFVDVSHCTGMDVSWNLAPDGTVAGITCSFRGSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.16
4 0.21
5 0.22
6 0.21
7 0.27
8 0.32
9 0.34
10 0.35
11 0.33
12 0.28
13 0.27
14 0.27
15 0.2
16 0.15
17 0.14
18 0.11
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.1
25 0.09
26 0.11
27 0.11
28 0.12
29 0.11
30 0.11
31 0.12
32 0.11
33 0.1
34 0.09
35 0.1
36 0.09
37 0.1
38 0.13
39 0.18
40 0.23
41 0.29
42 0.34
43 0.42
44 0.49
45 0.56
46 0.6
47 0.63
48 0.66
49 0.71
50 0.76
51 0.77
52 0.79
53 0.82
54 0.83
55 0.83
56 0.82
57 0.81
58 0.81
59 0.82
60 0.84
61 0.85
62 0.86
63 0.89
64 0.9
65 0.91
66 0.92
67 0.92
68 0.93
69 0.92
70 0.87
71 0.85
72 0.79
73 0.71
74 0.61
75 0.52
76 0.42
77 0.34
78 0.28
79 0.19
80 0.15
81 0.12
82 0.11
83 0.13
84 0.16
85 0.15
86 0.19
87 0.2
88 0.21
89 0.22
90 0.26
91 0.24
92 0.23
93 0.21
94 0.18
95 0.2
96 0.19
97 0.2
98 0.15
99 0.13
100 0.11
101 0.11
102 0.1
103 0.1
104 0.11
105 0.11
106 0.13
107 0.13
108 0.13
109 0.13
110 0.13
111 0.1
112 0.09
113 0.08
114 0.06
115 0.06
116 0.07
117 0.09
118 0.1
119 0.09
120 0.1