Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F7S6

Protein Details
Accession A0A5J5F7S6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-72NCCAARQSRRSLRFKLRRVSIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4.5, cyto_mito 9.5, extr 6, mito 13.5
Family & Domain DBs
Amino Acid Sequences MWTLRVSLMITSFLRRWGGLRAGGLPVYPATPNCPCRMNSNHSTGCLFNTANCCAARQSRRSLRFKLRRVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.2
5 0.22
6 0.2
7 0.21
8 0.19
9 0.19
10 0.19
11 0.18
12 0.13
13 0.1
14 0.09
15 0.09
16 0.07
17 0.1
18 0.15
19 0.17
20 0.18
21 0.2
22 0.2
23 0.26
24 0.31
25 0.33
26 0.33
27 0.39
28 0.38
29 0.37
30 0.38
31 0.32
32 0.28
33 0.24
34 0.2
35 0.15
36 0.17
37 0.17
38 0.19
39 0.19
40 0.19
41 0.19
42 0.27
43 0.31
44 0.33
45 0.41
46 0.48
47 0.58
48 0.63
49 0.7
50 0.73
51 0.77
52 0.81