Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EZL6

Protein Details
Accession A0A5J5EZL6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
25-44YGKLPSKKDILKNKLKERKYBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 11.499, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006760  Endosulphine  
Pfam View protein in Pfam  
PF04667  Endosulfine  
Amino Acid Sequences MLPHQRNKVDISSLSAEEQKLFRLYGKLPSKKDILKNKLKERKYFDSGDYALSKAGKASDVGVTNIGSQHPLPENIPHIHSTPNASDPSPVKEHTHLRSSPMAGEAPVTAEELEAAAAAAEEETKVEEKAEAVAELDKEEQLVEVREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.27
4 0.24
5 0.24
6 0.2
7 0.18
8 0.17
9 0.17
10 0.18
11 0.2
12 0.27
13 0.37
14 0.42
15 0.43
16 0.47
17 0.51
18 0.53
19 0.6
20 0.61
21 0.61
22 0.63
23 0.7
24 0.77
25 0.8
26 0.79
27 0.78
28 0.76
29 0.74
30 0.69
31 0.63
32 0.54
33 0.51
34 0.46
35 0.42
36 0.34
37 0.26
38 0.22
39 0.19
40 0.17
41 0.11
42 0.11
43 0.08
44 0.07
45 0.08
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.08
55 0.06
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.13
62 0.14
63 0.15
64 0.15
65 0.14
66 0.15
67 0.15
68 0.16
69 0.14
70 0.16
71 0.16
72 0.14
73 0.16
74 0.16
75 0.2
76 0.2
77 0.2
78 0.2
79 0.23
80 0.29
81 0.3
82 0.35
83 0.32
84 0.33
85 0.34
86 0.33
87 0.29
88 0.25
89 0.22
90 0.15
91 0.15
92 0.12
93 0.1
94 0.09
95 0.09
96 0.07
97 0.06
98 0.06
99 0.06
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.05
111 0.06
112 0.07
113 0.07
114 0.08
115 0.08
116 0.1
117 0.11
118 0.1
119 0.1
120 0.12
121 0.12
122 0.13
123 0.14
124 0.12
125 0.11
126 0.11
127 0.1
128 0.1