Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EH49

Protein Details
Accession A0A5J5EH49    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-67SIEERNKRRKDVRNQHQRHRRELBasic
NLS Segment(s)
PositionSequence
47-72EERNKRRKDVRNQHQRHRRELSKEKA
Subcellular Location(s) nucl 22, mito_nucl 13.333, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MIRHIRKKRENEMRTPHAPQPHLNLNDESIGYKLRISQRELKRLSIEERNKRRKDVRNQHQRHRRELSKEKAKENAAAYGDVTDWWRFDKTVKYSHMASTKRRLEENYKFLPTDPLLASNKMEGCFCFNLHFSLPGSVPEDLDKKVTGSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.75
3 0.7
4 0.66
5 0.61
6 0.54
7 0.51
8 0.52
9 0.49
10 0.46
11 0.42
12 0.36
13 0.35
14 0.32
15 0.25
16 0.17
17 0.15
18 0.12
19 0.11
20 0.15
21 0.21
22 0.24
23 0.29
24 0.38
25 0.45
26 0.54
27 0.56
28 0.54
29 0.5
30 0.5
31 0.49
32 0.49
33 0.51
34 0.52
35 0.6
36 0.68
37 0.67
38 0.7
39 0.74
40 0.74
41 0.76
42 0.77
43 0.77
44 0.77
45 0.82
46 0.86
47 0.86
48 0.81
49 0.77
50 0.74
51 0.69
52 0.66
53 0.69
54 0.68
55 0.69
56 0.69
57 0.63
58 0.61
59 0.56
60 0.51
61 0.43
62 0.36
63 0.27
64 0.23
65 0.2
66 0.15
67 0.14
68 0.1
69 0.11
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.1
76 0.16
77 0.19
78 0.26
79 0.28
80 0.3
81 0.31
82 0.35
83 0.41
84 0.38
85 0.39
86 0.42
87 0.46
88 0.45
89 0.45
90 0.45
91 0.46
92 0.51
93 0.54
94 0.5
95 0.47
96 0.45
97 0.43
98 0.44
99 0.35
100 0.31
101 0.24
102 0.23
103 0.23
104 0.24
105 0.24
106 0.23
107 0.24
108 0.21
109 0.21
110 0.16
111 0.19
112 0.19
113 0.19
114 0.19
115 0.18
116 0.2
117 0.2
118 0.22
119 0.18
120 0.2
121 0.19
122 0.19
123 0.21
124 0.19
125 0.18
126 0.2
127 0.21
128 0.2
129 0.21
130 0.2
131 0.17