Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EK30

Protein Details
Accession A0A5J5EK30    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-35ASGQSDIAKKRKPKPKPKPKPKQLPSHQEKKPEBasic
NLS Segment(s)
PositionSequence
11-34KKRKPKPKPKPKPKQLPSHQEKKP
Subcellular Location(s) nucl 23.5, cyto_nucl 14.333, mito_nucl 12.666
Family & Domain DBs
Amino Acid Sequences MTASGQSDIAKKRKPKPKPKPKPKQLPSHQEKKPENDNPGKIPKVTGRTSACNRVCLPGHEMATDNQQPGLAATQKPASASAVQDITVSVQVDVSNYTAMDIAWNLSPNGTISGMTFSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.82
4 0.87
5 0.91
6 0.94
7 0.95
8 0.96
9 0.97
10 0.94
11 0.94
12 0.92
13 0.92
14 0.89
15 0.87
16 0.81
17 0.79
18 0.75
19 0.7
20 0.7
21 0.65
22 0.64
23 0.62
24 0.61
25 0.57
26 0.6
27 0.55
28 0.45
29 0.41
30 0.38
31 0.36
32 0.34
33 0.35
34 0.31
35 0.36
36 0.4
37 0.47
38 0.43
39 0.41
40 0.39
41 0.36
42 0.34
43 0.29
44 0.28
45 0.22
46 0.21
47 0.18
48 0.19
49 0.16
50 0.2
51 0.2
52 0.16
53 0.13
54 0.12
55 0.12
56 0.11
57 0.12
58 0.1
59 0.09
60 0.1
61 0.12
62 0.12
63 0.13
64 0.13
65 0.13
66 0.11
67 0.12
68 0.13
69 0.12
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1
75 0.1
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.1
92 0.09
93 0.09
94 0.1
95 0.1
96 0.12
97 0.12
98 0.1
99 0.1
100 0.14