Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F826

Protein Details
Accession A0A5J5F826    Localization Confidence High Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-54LKTHNLSAIKERKHRKKKKQGKSWEHEDDTPBasic
173-195AGFEAAKRKRGKKRDDSPDPWAEBasic
NLS Segment(s)
PositionSequence
33-45KERKHRKKKKQGK
78-79KR
121-137RGGNGAEKGPLKKKERA
178-187AKRKRGKKRD
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPNKKSRNKGKFEPDFDLPPTSLLKTHNLSAIKERKHRKKKKQGKSWEHEDDTPKAFARLMAGGPKRCGLDNGSAGRKRKRQNNEEQELKAARADLKIQPGESLGAFARRVDAAIPVKFPRGGNGAEKGPLKKKERAKEVVEPTEEEIEEEEIHSDDDEEEEDKKEMLRQAQAGFEAAKRKRGKKRDDSPDPWAELEKRREAIKFGEVAHAPPTLKKPKPLLYMAGTKGNRAAVDVDGVPKSAGSLAKREELAGERRSLIEAYRKMMGEKRAGETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.61
4 0.55
5 0.44
6 0.36
7 0.32
8 0.27
9 0.25
10 0.22
11 0.25
12 0.25
13 0.26
14 0.31
15 0.31
16 0.32
17 0.39
18 0.45
19 0.47
20 0.53
21 0.62
22 0.67
23 0.76
24 0.85
25 0.86
26 0.89
27 0.92
28 0.95
29 0.95
30 0.95
31 0.95
32 0.93
33 0.91
34 0.89
35 0.83
36 0.77
37 0.71
38 0.64
39 0.56
40 0.49
41 0.39
42 0.3
43 0.26
44 0.21
45 0.19
46 0.16
47 0.15
48 0.21
49 0.25
50 0.27
51 0.28
52 0.3
53 0.29
54 0.27
55 0.27
56 0.22
57 0.23
58 0.27
59 0.31
60 0.36
61 0.4
62 0.45
63 0.5
64 0.55
65 0.56
66 0.6
67 0.64
68 0.66
69 0.73
70 0.79
71 0.8
72 0.78
73 0.72
74 0.67
75 0.58
76 0.49
77 0.38
78 0.28
79 0.21
80 0.16
81 0.18
82 0.16
83 0.2
84 0.21
85 0.2
86 0.19
87 0.18
88 0.18
89 0.15
90 0.14
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.08
97 0.09
98 0.07
99 0.12
100 0.14
101 0.14
102 0.17
103 0.16
104 0.17
105 0.19
106 0.19
107 0.16
108 0.15
109 0.16
110 0.16
111 0.18
112 0.18
113 0.19
114 0.21
115 0.22
116 0.25
117 0.31
118 0.33
119 0.38
120 0.44
121 0.49
122 0.55
123 0.59
124 0.57
125 0.59
126 0.6
127 0.57
128 0.51
129 0.44
130 0.37
131 0.32
132 0.27
133 0.19
134 0.13
135 0.09
136 0.08
137 0.07
138 0.07
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.07
149 0.08
150 0.08
151 0.08
152 0.1
153 0.12
154 0.14
155 0.15
156 0.16
157 0.17
158 0.18
159 0.18
160 0.17
161 0.15
162 0.15
163 0.21
164 0.19
165 0.27
166 0.31
167 0.4
168 0.48
169 0.57
170 0.65
171 0.68
172 0.78
173 0.8
174 0.85
175 0.82
176 0.8
177 0.77
178 0.68
179 0.58
180 0.5
181 0.43
182 0.4
183 0.39
184 0.36
185 0.32
186 0.33
187 0.33
188 0.32
189 0.32
190 0.29
191 0.26
192 0.23
193 0.27
194 0.25
195 0.25
196 0.25
197 0.24
198 0.2
199 0.2
200 0.26
201 0.3
202 0.32
203 0.38
204 0.43
205 0.48
206 0.54
207 0.55
208 0.52
209 0.48
210 0.53
211 0.5
212 0.52
213 0.44
214 0.39
215 0.38
216 0.34
217 0.29
218 0.22
219 0.21
220 0.13
221 0.15
222 0.15
223 0.16
224 0.15
225 0.15
226 0.14
227 0.12
228 0.12
229 0.12
230 0.15
231 0.14
232 0.19
233 0.22
234 0.26
235 0.27
236 0.27
237 0.27
238 0.28
239 0.33
240 0.31
241 0.3
242 0.28
243 0.28
244 0.29
245 0.27
246 0.25
247 0.28
248 0.28
249 0.29
250 0.32
251 0.32
252 0.33
253 0.39
254 0.41
255 0.39
256 0.4