Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5F1J7

Protein Details
Accession A0A5J5F1J7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
366-387DTPALPSTKKYRKTPPPSAFFRHydrophilic
NLS Segment(s)
PositionSequence
62-114RRSGIRRSIGRRASKILEKVARAGNEDVVPKITPPPKRLLKAGGGRRGRRNAS
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MFPSDRPLPRTPSFSRKVAKRVSSLIAKFEALSANQSTVIDPEPPRRRSLSSLITPGGSSSRRSGIRRSIGRRASKILEKVARAGNEDVVPKITPPPKRLLKAGGGRRGRRNASLPNAAGVRVARYTVKKRRVVSDSTEVSGIVLDGPVSLFASEQPSSSIAYAASSILSTPPPPVAKILPSSFFSQLVSEEPPRRRKVKPQTFTDSEDTDLVVVEMAEKVDLRHQFRLKPTTNGTGSGWRRKITPPKISVRELVSRFWQEPSQQQKREAVKVPEQKAVEEKIPVEERDEKYSNIVTAFSDAEDAEDASEAEQEDEGIMLWPGEASPSISSLLRFSTPSSSSVTRPHTSGSIVPTPKTYVSPLRLDTPALPSTKKYRKTPPPSAFFRHNGKRLRYSAIATSPNSASSSESYYFSSSSSEGRGKSTITISPNRGGGITINTGIPAESILTPIPVNAVQGQAIRHLVTQSWGVHMLEGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.66
4 0.71
5 0.72
6 0.72
7 0.67
8 0.66
9 0.65
10 0.65
11 0.6
12 0.55
13 0.48
14 0.42
15 0.37
16 0.33
17 0.29
18 0.2
19 0.22
20 0.19
21 0.17
22 0.18
23 0.18
24 0.17
25 0.16
26 0.17
27 0.19
28 0.2
29 0.29
30 0.38
31 0.4
32 0.43
33 0.45
34 0.48
35 0.48
36 0.54
37 0.53
38 0.5
39 0.53
40 0.51
41 0.47
42 0.43
43 0.38
44 0.35
45 0.27
46 0.23
47 0.2
48 0.26
49 0.31
50 0.34
51 0.4
52 0.44
53 0.53
54 0.6
55 0.64
56 0.67
57 0.69
58 0.75
59 0.72
60 0.68
61 0.65
62 0.63
63 0.6
64 0.59
65 0.56
66 0.49
67 0.5
68 0.49
69 0.44
70 0.4
71 0.37
72 0.31
73 0.28
74 0.28
75 0.24
76 0.21
77 0.2
78 0.17
79 0.23
80 0.26
81 0.29
82 0.31
83 0.4
84 0.46
85 0.49
86 0.52
87 0.51
88 0.53
89 0.57
90 0.62
91 0.62
92 0.62
93 0.65
94 0.7
95 0.72
96 0.66
97 0.62
98 0.59
99 0.57
100 0.56
101 0.57
102 0.49
103 0.45
104 0.42
105 0.37
106 0.33
107 0.25
108 0.19
109 0.13
110 0.14
111 0.14
112 0.2
113 0.3
114 0.38
115 0.47
116 0.51
117 0.54
118 0.61
119 0.62
120 0.61
121 0.58
122 0.57
123 0.51
124 0.45
125 0.42
126 0.34
127 0.29
128 0.24
129 0.17
130 0.08
131 0.05
132 0.04
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.09
141 0.09
142 0.09
143 0.1
144 0.11
145 0.12
146 0.12
147 0.12
148 0.07
149 0.08
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.07
159 0.1
160 0.1
161 0.11
162 0.13
163 0.13
164 0.15
165 0.19
166 0.2
167 0.19
168 0.2
169 0.23
170 0.22
171 0.21
172 0.19
173 0.16
174 0.14
175 0.14
176 0.15
177 0.16
178 0.22
179 0.28
180 0.35
181 0.4
182 0.44
183 0.45
184 0.52
185 0.59
186 0.64
187 0.65
188 0.66
189 0.69
190 0.69
191 0.7
192 0.63
193 0.53
194 0.43
195 0.35
196 0.27
197 0.18
198 0.14
199 0.09
200 0.06
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.04
208 0.08
209 0.13
210 0.16
211 0.22
212 0.24
213 0.28
214 0.32
215 0.41
216 0.38
217 0.38
218 0.39
219 0.39
220 0.37
221 0.35
222 0.32
223 0.32
224 0.33
225 0.37
226 0.35
227 0.3
228 0.31
229 0.35
230 0.44
231 0.43
232 0.48
233 0.47
234 0.54
235 0.58
236 0.58
237 0.56
238 0.5
239 0.48
240 0.42
241 0.36
242 0.31
243 0.28
244 0.27
245 0.26
246 0.23
247 0.18
248 0.24
249 0.33
250 0.38
251 0.39
252 0.41
253 0.47
254 0.49
255 0.53
256 0.52
257 0.47
258 0.46
259 0.52
260 0.52
261 0.5
262 0.46
263 0.41
264 0.38
265 0.36
266 0.28
267 0.21
268 0.18
269 0.17
270 0.19
271 0.19
272 0.19
273 0.24
274 0.25
275 0.3
276 0.32
277 0.28
278 0.28
279 0.28
280 0.25
281 0.19
282 0.17
283 0.11
284 0.11
285 0.11
286 0.08
287 0.08
288 0.07
289 0.07
290 0.07
291 0.07
292 0.05
293 0.05
294 0.05
295 0.04
296 0.05
297 0.05
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.04
305 0.04
306 0.04
307 0.04
308 0.03
309 0.03
310 0.04
311 0.04
312 0.05
313 0.05
314 0.06
315 0.08
316 0.08
317 0.09
318 0.09
319 0.11
320 0.11
321 0.11
322 0.12
323 0.15
324 0.16
325 0.17
326 0.21
327 0.22
328 0.23
329 0.29
330 0.34
331 0.31
332 0.3
333 0.3
334 0.27
335 0.26
336 0.27
337 0.26
338 0.27
339 0.28
340 0.27
341 0.27
342 0.28
343 0.27
344 0.26
345 0.25
346 0.23
347 0.27
348 0.31
349 0.31
350 0.33
351 0.33
352 0.33
353 0.31
354 0.29
355 0.29
356 0.26
357 0.25
358 0.24
359 0.33
360 0.41
361 0.47
362 0.48
363 0.55
364 0.64
365 0.73
366 0.81
367 0.8
368 0.8
369 0.8
370 0.79
371 0.76
372 0.71
373 0.71
374 0.69
375 0.68
376 0.67
377 0.66
378 0.68
379 0.64
380 0.64
381 0.57
382 0.51
383 0.49
384 0.48
385 0.47
386 0.4
387 0.4
388 0.34
389 0.33
390 0.3
391 0.25
392 0.2
393 0.17
394 0.21
395 0.19
396 0.2
397 0.21
398 0.22
399 0.21
400 0.19
401 0.19
402 0.15
403 0.15
404 0.19
405 0.21
406 0.21
407 0.24
408 0.25
409 0.24
410 0.26
411 0.27
412 0.27
413 0.29
414 0.35
415 0.36
416 0.38
417 0.39
418 0.36
419 0.33
420 0.29
421 0.25
422 0.22
423 0.2
424 0.17
425 0.16
426 0.16
427 0.16
428 0.15
429 0.13
430 0.09
431 0.08
432 0.07
433 0.09
434 0.09
435 0.1
436 0.1
437 0.1
438 0.13
439 0.11
440 0.13
441 0.12
442 0.13
443 0.14
444 0.16
445 0.17
446 0.18
447 0.2
448 0.18
449 0.18
450 0.18
451 0.17
452 0.17
453 0.22
454 0.19
455 0.2
456 0.22
457 0.21
458 0.21