Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EVM7

Protein Details
Accession A0A5J5EVM7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
202-224VSEGDKRTRRRKAVSPSHKRVSMHydrophilic
NLS Segment(s)
PositionSequence
205-217GDKRTRRRKAVSP
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MCAVSPYPTTRPLSADPAHGNRLPSDTACATISSVSIIPISRPPLRRTAGSGPYCIDDSVGRFCGSSYRRCADLGQHTQGSETRGSGAQGPGRAQISNGKELGFASVVSADSLFAHTHVLRYTPLSFVASVNSGSVFFGILSRKTNRSILEFSAQLPASAELSAMCIEGVEEGPCAIPVAVTLAVRLTSAWFRLSFRKLRGVSEGDKRTRRRKAVSPSHKRVSMQMKPYFGILPDFFFFCTHPRCSNFTPEIFTYIPTSTAEFSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.43
4 0.44
5 0.47
6 0.45
7 0.42
8 0.36
9 0.37
10 0.32
11 0.26
12 0.26
13 0.22
14 0.22
15 0.21
16 0.2
17 0.17
18 0.16
19 0.15
20 0.11
21 0.11
22 0.09
23 0.1
24 0.09
25 0.1
26 0.14
27 0.19
28 0.24
29 0.28
30 0.31
31 0.38
32 0.41
33 0.41
34 0.44
35 0.47
36 0.5
37 0.48
38 0.47
39 0.4
40 0.38
41 0.37
42 0.3
43 0.23
44 0.14
45 0.14
46 0.17
47 0.17
48 0.15
49 0.14
50 0.14
51 0.21
52 0.23
53 0.27
54 0.29
55 0.3
56 0.31
57 0.32
58 0.34
59 0.33
60 0.39
61 0.4
62 0.38
63 0.37
64 0.35
65 0.36
66 0.36
67 0.31
68 0.22
69 0.16
70 0.13
71 0.12
72 0.13
73 0.14
74 0.15
75 0.15
76 0.16
77 0.16
78 0.17
79 0.17
80 0.17
81 0.15
82 0.19
83 0.2
84 0.21
85 0.21
86 0.19
87 0.18
88 0.18
89 0.19
90 0.12
91 0.09
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.06
100 0.06
101 0.05
102 0.07
103 0.07
104 0.08
105 0.08
106 0.09
107 0.08
108 0.1
109 0.1
110 0.09
111 0.1
112 0.1
113 0.1
114 0.09
115 0.1
116 0.09
117 0.08
118 0.07
119 0.07
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.06
127 0.07
128 0.1
129 0.13
130 0.15
131 0.17
132 0.2
133 0.19
134 0.22
135 0.24
136 0.23
137 0.24
138 0.22
139 0.21
140 0.23
141 0.21
142 0.17
143 0.15
144 0.13
145 0.11
146 0.1
147 0.09
148 0.05
149 0.06
150 0.06
151 0.06
152 0.05
153 0.04
154 0.04
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.04
164 0.04
165 0.03
166 0.06
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.09
177 0.1
178 0.11
179 0.13
180 0.19
181 0.25
182 0.29
183 0.31
184 0.39
185 0.39
186 0.41
187 0.44
188 0.43
189 0.42
190 0.46
191 0.51
192 0.5
193 0.57
194 0.62
195 0.66
196 0.7
197 0.72
198 0.69
199 0.7
200 0.74
201 0.77
202 0.81
203 0.83
204 0.83
205 0.83
206 0.79
207 0.71
208 0.68
209 0.66
210 0.63
211 0.62
212 0.58
213 0.53
214 0.5
215 0.51
216 0.44
217 0.35
218 0.32
219 0.24
220 0.22
221 0.2
222 0.2
223 0.19
224 0.19
225 0.19
226 0.19
227 0.24
228 0.25
229 0.3
230 0.33
231 0.39
232 0.42
233 0.5
234 0.5
235 0.48
236 0.49
237 0.44
238 0.45
239 0.39
240 0.36
241 0.31
242 0.26
243 0.24
244 0.2
245 0.2
246 0.17