Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EMI1

Protein Details
Accession A0A5J5EMI1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSTRKRPPRPYVPKLPGYRIGHydrophilic
NLS Segment(s)
PositionSequence
6-30KRPPRPYVPKLPGYRIGAGKAPRSR
268-278KRRAEAGRRVR
Subcellular Location(s) cyto 4.5, cyto_nucl 9, mito 10, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MPSTRKRPPRPYVPKLPGYRIGAGKAPRSRAVKNNGETMPAASVPPPLPLPHRRYPAPSPRRVATPQSHSTAPASSVPQEGPPPPPPPQQRFGGPTGILRNPFAHSQGVEYPQRIRLITRHSVTAAATPAVFPSSPSSSSCSSSSEDDDEEEDEDEDDGDETETDTDRPSAPAHRYHTPAPSMTASQDLAPLFFPPTPPLPPEVPAGRLASPTPLDLSETDVAGQQLRGVQSEIALRQARIVQMKAQEKKLNARIEKVLQGGIEECKKRRAEAGRRVRRGLLGQVDSWNREFEASLEAAMRFEMAWKAADGEEDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.8
4 0.76
5 0.71
6 0.67
7 0.59
8 0.52
9 0.49
10 0.47
11 0.48
12 0.46
13 0.46
14 0.46
15 0.49
16 0.52
17 0.55
18 0.6
19 0.61
20 0.59
21 0.62
22 0.56
23 0.53
24 0.48
25 0.41
26 0.34
27 0.25
28 0.22
29 0.14
30 0.17
31 0.15
32 0.16
33 0.16
34 0.15
35 0.22
36 0.3
37 0.37
38 0.42
39 0.47
40 0.48
41 0.54
42 0.62
43 0.66
44 0.67
45 0.68
46 0.65
47 0.62
48 0.65
49 0.63
50 0.61
51 0.57
52 0.56
53 0.53
54 0.51
55 0.49
56 0.44
57 0.41
58 0.35
59 0.29
60 0.23
61 0.2
62 0.18
63 0.19
64 0.18
65 0.18
66 0.19
67 0.19
68 0.22
69 0.24
70 0.27
71 0.29
72 0.37
73 0.43
74 0.46
75 0.49
76 0.48
77 0.48
78 0.49
79 0.47
80 0.43
81 0.35
82 0.33
83 0.33
84 0.32
85 0.28
86 0.25
87 0.24
88 0.22
89 0.22
90 0.21
91 0.17
92 0.14
93 0.16
94 0.18
95 0.21
96 0.21
97 0.21
98 0.21
99 0.23
100 0.24
101 0.22
102 0.2
103 0.2
104 0.25
105 0.3
106 0.3
107 0.28
108 0.27
109 0.27
110 0.26
111 0.24
112 0.18
113 0.12
114 0.1
115 0.09
116 0.08
117 0.08
118 0.08
119 0.06
120 0.09
121 0.1
122 0.12
123 0.13
124 0.16
125 0.17
126 0.19
127 0.19
128 0.18
129 0.18
130 0.18
131 0.19
132 0.17
133 0.15
134 0.13
135 0.13
136 0.11
137 0.1
138 0.09
139 0.08
140 0.07
141 0.06
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.03
149 0.04
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.08
157 0.12
158 0.14
159 0.2
160 0.24
161 0.27
162 0.3
163 0.31
164 0.33
165 0.31
166 0.29
167 0.25
168 0.22
169 0.19
170 0.17
171 0.16
172 0.13
173 0.12
174 0.13
175 0.11
176 0.1
177 0.09
178 0.09
179 0.09
180 0.09
181 0.09
182 0.09
183 0.12
184 0.13
185 0.14
186 0.17
187 0.16
188 0.18
189 0.21
190 0.2
191 0.2
192 0.2
193 0.21
194 0.18
195 0.18
196 0.17
197 0.16
198 0.15
199 0.13
200 0.12
201 0.1
202 0.11
203 0.1
204 0.15
205 0.13
206 0.12
207 0.12
208 0.12
209 0.12
210 0.11
211 0.11
212 0.07
213 0.09
214 0.09
215 0.1
216 0.1
217 0.09
218 0.1
219 0.13
220 0.13
221 0.17
222 0.18
223 0.17
224 0.18
225 0.2
226 0.22
227 0.22
228 0.23
229 0.21
230 0.28
231 0.37
232 0.4
233 0.45
234 0.46
235 0.46
236 0.53
237 0.57
238 0.58
239 0.52
240 0.51
241 0.5
242 0.49
243 0.5
244 0.43
245 0.36
246 0.27
247 0.26
248 0.23
249 0.23
250 0.26
251 0.26
252 0.27
253 0.33
254 0.34
255 0.34
256 0.41
257 0.46
258 0.5
259 0.57
260 0.66
261 0.7
262 0.75
263 0.77
264 0.71
265 0.64
266 0.57
267 0.54
268 0.51
269 0.43
270 0.39
271 0.42
272 0.43
273 0.42
274 0.4
275 0.34
276 0.26
277 0.23
278 0.21
279 0.16
280 0.17
281 0.14
282 0.14
283 0.15
284 0.14
285 0.14
286 0.13
287 0.13
288 0.08
289 0.1
290 0.11
291 0.1
292 0.11
293 0.11
294 0.14
295 0.14
296 0.15