Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F6A5

Protein Details
Accession A0A5J5F6A5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-41ATDRVPRREHRRRGSAPCKTGBasic
NLS Segment(s)
PositionSequence
30-33HRRR
Subcellular Location(s) extr 16, plas 5, E.R. 3, mito 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLPAIAVVLHSLIVSWLFNVATDRVPRREHRRRGSAPCKTGKKTTNNATRRYIARYHRRAFFLRITLLFPCTDAPSELFSHNNRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.08
7 0.09
8 0.12
9 0.16
10 0.2
11 0.23
12 0.28
13 0.34
14 0.43
15 0.53
16 0.59
17 0.63
18 0.7
19 0.73
20 0.79
21 0.82
22 0.8
23 0.77
24 0.75
25 0.73
26 0.66
27 0.66
28 0.62
29 0.59
30 0.57
31 0.6
32 0.61
33 0.6
34 0.62
35 0.59
36 0.56
37 0.51
38 0.49
39 0.46
40 0.45
41 0.5
42 0.55
43 0.56
44 0.57
45 0.59
46 0.58
47 0.56
48 0.52
49 0.45
50 0.4
51 0.36
52 0.33
53 0.3
54 0.28
55 0.23
56 0.19
57 0.16
58 0.15
59 0.15
60 0.14
61 0.14
62 0.16
63 0.18
64 0.19
65 0.22
66 0.25