Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F3S8

Protein Details
Accession A0A5J5F3S8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-185ELISVRRQRKLKMKKHKYKKLMKKTRNERRRIERQRSBasic
NLS Segment(s)
PositionSequence
154-185RRQRKLKMKKHKYKKLMKKTRNERRRIERQRS
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLPALARCLGAAAPSSFATKTLRAAYSSSSSSKPSSPADGSRSSPRAALVEQQVATQAPRAAAGKPGSGIPFVPSTDHLHPSDVALSTFFALHRPISIVSHFPPSSTPRAPPRNVESRVVEEGPWAYGVPFRPPPVPQEESEDGQRFYELISVRRQRKLKMKKHKYKKLMKKTRNERRRIERQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.16
5 0.18
6 0.17
7 0.2
8 0.23
9 0.23
10 0.23
11 0.24
12 0.26
13 0.27
14 0.29
15 0.28
16 0.25
17 0.26
18 0.27
19 0.27
20 0.27
21 0.25
22 0.28
23 0.28
24 0.31
25 0.33
26 0.35
27 0.37
28 0.41
29 0.41
30 0.36
31 0.33
32 0.29
33 0.26
34 0.23
35 0.25
36 0.21
37 0.22
38 0.22
39 0.21
40 0.21
41 0.19
42 0.18
43 0.15
44 0.13
45 0.08
46 0.1
47 0.11
48 0.1
49 0.15
50 0.16
51 0.14
52 0.14
53 0.15
54 0.14
55 0.14
56 0.13
57 0.1
58 0.1
59 0.1
60 0.1
61 0.11
62 0.16
63 0.18
64 0.21
65 0.19
66 0.19
67 0.19
68 0.19
69 0.18
70 0.13
71 0.11
72 0.08
73 0.08
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.07
83 0.08
84 0.09
85 0.1
86 0.1
87 0.16
88 0.16
89 0.15
90 0.17
91 0.19
92 0.24
93 0.23
94 0.26
95 0.3
96 0.37
97 0.38
98 0.41
99 0.43
100 0.47
101 0.49
102 0.48
103 0.42
104 0.4
105 0.41
106 0.37
107 0.31
108 0.22
109 0.2
110 0.17
111 0.14
112 0.1
113 0.07
114 0.08
115 0.09
116 0.13
117 0.16
118 0.17
119 0.19
120 0.2
121 0.24
122 0.29
123 0.31
124 0.27
125 0.33
126 0.34
127 0.35
128 0.4
129 0.39
130 0.32
131 0.29
132 0.28
133 0.2
134 0.16
135 0.18
136 0.14
137 0.14
138 0.23
139 0.32
140 0.38
141 0.46
142 0.49
143 0.52
144 0.61
145 0.7
146 0.71
147 0.74
148 0.8
149 0.83
150 0.91
151 0.94
152 0.94
153 0.94
154 0.95
155 0.94
156 0.94
157 0.93
158 0.93
159 0.93
160 0.94
161 0.93
162 0.91
163 0.9
164 0.89
165 0.91