Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F8P6

Protein Details
Accession A0A5J5F8P6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-82AASPLTLDKRKPRRLRRSRMSVENEAHydrophilic
133-152LSCKQTIGRGRKRQRNTPTIHydrophilic
NLS Segment(s)
PositionSequence
65-74KRKPRRLRRS
Subcellular Location(s) E.R. 1, cyto 1, extr 6, golg 1, mito 8, plas 9, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIFFPCCGISSHRSPYHASLLSAGSVIPYQCHRNERSGGTCKTLRWRIDVYKAAAAAASPLTLDKRKPRRLRRSRMSVENEARWVAGGGGGGMFLHARFFFLIQHGYAVSPPNIFDNGGGDDAVGTSCSCSCLSCKQTIGRGRKRQRNTPTIHHAHPHSRTCRIVAVSIVPLIFQYFVTFCRFFILFFFYFGFLRCWPLGPLSGCLSSDATTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.46
5 0.39
6 0.33
7 0.3
8 0.28
9 0.24
10 0.2
11 0.12
12 0.11
13 0.1
14 0.1
15 0.12
16 0.16
17 0.21
18 0.28
19 0.3
20 0.34
21 0.39
22 0.42
23 0.47
24 0.51
25 0.49
26 0.49
27 0.48
28 0.45
29 0.5
30 0.52
31 0.45
32 0.42
33 0.46
34 0.45
35 0.51
36 0.53
37 0.47
38 0.43
39 0.41
40 0.36
41 0.3
42 0.24
43 0.17
44 0.11
45 0.08
46 0.05
47 0.05
48 0.08
49 0.1
50 0.14
51 0.23
52 0.33
53 0.43
54 0.54
55 0.64
56 0.72
57 0.82
58 0.89
59 0.89
60 0.9
61 0.87
62 0.86
63 0.82
64 0.8
65 0.74
66 0.65
67 0.56
68 0.45
69 0.38
70 0.29
71 0.21
72 0.12
73 0.08
74 0.06
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.02
82 0.03
83 0.03
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.03
113 0.03
114 0.04
115 0.05
116 0.06
117 0.06
118 0.08
119 0.15
120 0.18
121 0.21
122 0.24
123 0.25
124 0.32
125 0.4
126 0.49
127 0.52
128 0.6
129 0.67
130 0.73
131 0.77
132 0.79
133 0.8
134 0.8
135 0.75
136 0.73
137 0.74
138 0.7
139 0.66
140 0.61
141 0.56
142 0.54
143 0.55
144 0.54
145 0.49
146 0.48
147 0.47
148 0.44
149 0.45
150 0.38
151 0.33
152 0.26
153 0.24
154 0.2
155 0.2
156 0.18
157 0.13
158 0.12
159 0.11
160 0.1
161 0.07
162 0.07
163 0.07
164 0.09
165 0.15
166 0.15
167 0.15
168 0.18
169 0.18
170 0.17
171 0.18
172 0.23
173 0.18
174 0.19
175 0.2
176 0.18
177 0.19
178 0.2
179 0.21
180 0.15
181 0.19
182 0.18
183 0.19
184 0.19
185 0.21
186 0.25
187 0.24
188 0.27
189 0.26
190 0.27
191 0.26
192 0.26
193 0.26