Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F4B3

Protein Details
Accession A0A5J5F4B3   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MHNHNRLSRAAAKKERKKVKLRPAPDVIHydrophilic
139-162SLGQWERMKRHRPRSRRYVFTWRTHydrophilic
NLS Segment(s)
PositionSequence
9-22RAAAKKERKKVKLR
Subcellular Location(s) cyto 2, mito 20, nucl 4
Family & Domain DBs
Amino Acid Sequences MHNHNRLSRAAAKKERKKVKLRPAPDVIDVTCWLVVAGINATRITTTTTTTTTTITMPLLSLPPELLLQIIALSPSLSAYLSLHDTCRTLRDFCRAAYPSGKGLAQLLRRERAADAHLDILCAIDFLPKLGDEQLRELSLGQWERMKRHRPRSRRYVFTWRTWGMEGRRTAETTMPLCQFRLRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.87
5 0.87
6 0.88
7 0.88
8 0.84
9 0.83
10 0.8
11 0.75
12 0.68
13 0.61
14 0.5
15 0.42
16 0.37
17 0.29
18 0.21
19 0.17
20 0.13
21 0.1
22 0.09
23 0.07
24 0.08
25 0.07
26 0.08
27 0.08
28 0.09
29 0.08
30 0.09
31 0.11
32 0.11
33 0.12
34 0.13
35 0.14
36 0.16
37 0.17
38 0.18
39 0.15
40 0.15
41 0.14
42 0.12
43 0.11
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.03
65 0.04
66 0.04
67 0.05
68 0.07
69 0.08
70 0.08
71 0.09
72 0.1
73 0.09
74 0.12
75 0.13
76 0.13
77 0.14
78 0.19
79 0.2
80 0.2
81 0.27
82 0.26
83 0.26
84 0.26
85 0.26
86 0.21
87 0.21
88 0.21
89 0.13
90 0.14
91 0.16
92 0.17
93 0.21
94 0.23
95 0.24
96 0.24
97 0.25
98 0.23
99 0.21
100 0.19
101 0.16
102 0.14
103 0.15
104 0.15
105 0.14
106 0.14
107 0.12
108 0.1
109 0.08
110 0.07
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.07
117 0.1
118 0.12
119 0.12
120 0.15
121 0.17
122 0.17
123 0.17
124 0.16
125 0.14
126 0.18
127 0.18
128 0.16
129 0.2
130 0.22
131 0.27
132 0.35
133 0.44
134 0.48
135 0.58
136 0.67
137 0.72
138 0.8
139 0.86
140 0.87
141 0.85
142 0.83
143 0.84
144 0.79
145 0.77
146 0.76
147 0.66
148 0.6
149 0.54
150 0.53
151 0.46
152 0.48
153 0.43
154 0.38
155 0.39
156 0.38
157 0.37
158 0.34
159 0.34
160 0.29
161 0.32
162 0.32
163 0.31
164 0.3