Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5ET85

Protein Details
Accession A0A5J5ET85   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRPPKTPRHKGKRGPTLSPDIBasic
NLS Segment(s)
PositionSequence
5-13KTPRHKGKR
41-48PRPTRSTR
Subcellular Location(s) cyto 4, cyto_nucl 6.5, mito 16, nucl 7
Family & Domain DBs
Amino Acid Sequences MRPPKTPRHKGKRGPTLSPDILSSPHAPTIYTPPSKGAKTPRPTRSTRKAAFPESPTRASRIGGVGPAARRTAKSNIAHQEGARQIAPRDGLADAAASVVEGAAINSALPPTAPKELVSGPGETICNAGRSASNRIGTLKEAGAFTTEATRSHAGSTTPQVPATGAYRWRSPLERREWMMDPYVAEIARRHRQGSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.79
4 0.71
5 0.62
6 0.52
7 0.42
8 0.37
9 0.33
10 0.28
11 0.21
12 0.21
13 0.2
14 0.19
15 0.19
16 0.26
17 0.3
18 0.3
19 0.29
20 0.31
21 0.35
22 0.36
23 0.4
24 0.42
25 0.44
26 0.51
27 0.6
28 0.64
29 0.66
30 0.72
31 0.76
32 0.76
33 0.77
34 0.71
35 0.71
36 0.68
37 0.67
38 0.66
39 0.62
40 0.61
41 0.55
42 0.56
43 0.48
44 0.45
45 0.4
46 0.34
47 0.3
48 0.23
49 0.19
50 0.15
51 0.15
52 0.15
53 0.15
54 0.16
55 0.16
56 0.14
57 0.14
58 0.17
59 0.21
60 0.26
61 0.27
62 0.33
63 0.37
64 0.41
65 0.41
66 0.37
67 0.37
68 0.31
69 0.29
70 0.23
71 0.18
72 0.15
73 0.15
74 0.16
75 0.11
76 0.11
77 0.09
78 0.08
79 0.07
80 0.07
81 0.05
82 0.05
83 0.04
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.02
96 0.02
97 0.03
98 0.06
99 0.08
100 0.08
101 0.08
102 0.11
103 0.12
104 0.16
105 0.17
106 0.15
107 0.13
108 0.15
109 0.14
110 0.12
111 0.13
112 0.09
113 0.09
114 0.09
115 0.09
116 0.1
117 0.13
118 0.18
119 0.21
120 0.22
121 0.22
122 0.24
123 0.24
124 0.24
125 0.23
126 0.18
127 0.15
128 0.14
129 0.13
130 0.13
131 0.12
132 0.11
133 0.13
134 0.13
135 0.11
136 0.15
137 0.17
138 0.16
139 0.17
140 0.18
141 0.15
142 0.18
143 0.22
144 0.22
145 0.23
146 0.22
147 0.21
148 0.2
149 0.21
150 0.2
151 0.2
152 0.21
153 0.23
154 0.25
155 0.28
156 0.32
157 0.36
158 0.4
159 0.45
160 0.49
161 0.54
162 0.55
163 0.58
164 0.57
165 0.54
166 0.51
167 0.43
168 0.35
169 0.29
170 0.28
171 0.23
172 0.21
173 0.21
174 0.25
175 0.32
176 0.35