Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EJZ6

Protein Details
Accession A0A5J5EJZ6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
167-193LKLTEIKMKWNLKRKSHPKGTRMMRMSHydrophilic
NLS Segment(s)
PositionSequence
178-189LKRKSHPKGTRM
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 10.5, pero 2
Family & Domain DBs
Amino Acid Sequences MSMDRRDTEPAPESEQEPEPEQMLIEDDASSPATPTPDKSTLYRSRMKYLKATIEKMEGLVEAAEAGEQVVKKQSAVQLPSEAGRHGKIKELRMQAEALVEKLNSMVIADEQEAHGREVFKIDGEELKRVVGEELKGAVGVKLKGTVGENLKRTVRRNLKLTIVATLKLTEIKMKWNLKRKSHPKGTRMMRMSGRRMIPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.33
4 0.31
5 0.29
6 0.24
7 0.22
8 0.2
9 0.16
10 0.15
11 0.13
12 0.1
13 0.09
14 0.09
15 0.1
16 0.11
17 0.1
18 0.09
19 0.09
20 0.11
21 0.11
22 0.14
23 0.2
24 0.23
25 0.25
26 0.27
27 0.35
28 0.41
29 0.47
30 0.52
31 0.48
32 0.53
33 0.55
34 0.57
35 0.54
36 0.51
37 0.55
38 0.52
39 0.53
40 0.46
41 0.44
42 0.41
43 0.35
44 0.29
45 0.19
46 0.14
47 0.1
48 0.08
49 0.05
50 0.04
51 0.04
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.08
58 0.08
59 0.08
60 0.11
61 0.15
62 0.18
63 0.2
64 0.2
65 0.19
66 0.2
67 0.21
68 0.2
69 0.16
70 0.13
71 0.13
72 0.14
73 0.13
74 0.19
75 0.21
76 0.24
77 0.31
78 0.34
79 0.34
80 0.32
81 0.32
82 0.26
83 0.24
84 0.21
85 0.14
86 0.1
87 0.09
88 0.07
89 0.07
90 0.06
91 0.04
92 0.04
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.07
100 0.07
101 0.08
102 0.09
103 0.09
104 0.09
105 0.1
106 0.1
107 0.09
108 0.08
109 0.08
110 0.12
111 0.13
112 0.14
113 0.13
114 0.13
115 0.13
116 0.13
117 0.13
118 0.1
119 0.09
120 0.09
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.09
129 0.1
130 0.1
131 0.11
132 0.12
133 0.16
134 0.2
135 0.26
136 0.27
137 0.3
138 0.35
139 0.38
140 0.4
141 0.46
142 0.49
143 0.5
144 0.53
145 0.53
146 0.54
147 0.56
148 0.53
149 0.49
150 0.41
151 0.35
152 0.31
153 0.27
154 0.22
155 0.19
156 0.19
157 0.17
158 0.16
159 0.22
160 0.3
161 0.38
162 0.45
163 0.54
164 0.62
165 0.67
166 0.77
167 0.81
168 0.83
169 0.85
170 0.87
171 0.83
172 0.85
173 0.84
174 0.83
175 0.77
176 0.74
177 0.71
178 0.7
179 0.7
180 0.68