Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W2I8

Protein Details
Accession H1W2I8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
195-222EKTPGLMGFAKRKNRRRRRPDGHRCVILBasic
NLS Segment(s)
PositionSequence
204-214AKRKNRRRRRP
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0032153  C:cell division site  
GO:0005935  C:cellular bud neck  
GO:0000131  C:incipient cellular bud site  
GO:0005886  C:plasma membrane  
GO:0005774  C:vacuolar membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007120  P:axial cellular bud site selection  
GO:0007121  P:bipolar cellular bud site selection  
GO:0000755  P:cytogamy  
GO:0045184  P:establishment of protein localization  
GO:0032507  P:maintenance of protein location in cell  
GO:0035025  P:positive regulation of Rho protein signal transduction  
GO:2000114  P:regulation of establishment of cell polarity  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG chig:CH63R_07487  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
Amino Acid Sequences MSRLNKHHQSCRELHVVVLGAGGVGKSCLTAQFVHNEWIESYDPTIEDTYRTQLQVDGRQVVLEILDTAGTEQFVAMRDLYMKSGQGFILVFSITSSSSMNEIEMLREEITRIKDDDNVPIVIVGNKADLEEQRSVPRQRAFACSQMWDAPYYETSARTRTNVDAVFIDICRQLLMKDEKFQSQVAQDDDEHEYEKTPGLMGFAKRKNRRRRRPDGHRCVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.35
4 0.27
5 0.23
6 0.16
7 0.09
8 0.08
9 0.08
10 0.05
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.08
17 0.1
18 0.12
19 0.17
20 0.19
21 0.22
22 0.23
23 0.22
24 0.21
25 0.22
26 0.21
27 0.17
28 0.16
29 0.13
30 0.12
31 0.13
32 0.14
33 0.11
34 0.12
35 0.13
36 0.17
37 0.18
38 0.18
39 0.17
40 0.19
41 0.22
42 0.27
43 0.29
44 0.26
45 0.24
46 0.23
47 0.23
48 0.2
49 0.16
50 0.09
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.07
63 0.06
64 0.06
65 0.08
66 0.08
67 0.1
68 0.1
69 0.09
70 0.09
71 0.1
72 0.1
73 0.09
74 0.09
75 0.07
76 0.08
77 0.07
78 0.06
79 0.05
80 0.06
81 0.05
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.08
96 0.09
97 0.11
98 0.12
99 0.12
100 0.11
101 0.15
102 0.16
103 0.18
104 0.18
105 0.16
106 0.15
107 0.14
108 0.14
109 0.1
110 0.1
111 0.07
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.09
118 0.11
119 0.12
120 0.16
121 0.21
122 0.23
123 0.27
124 0.29
125 0.29
126 0.3
127 0.35
128 0.34
129 0.33
130 0.33
131 0.3
132 0.29
133 0.27
134 0.26
135 0.2
136 0.18
137 0.15
138 0.14
139 0.14
140 0.13
141 0.14
142 0.15
143 0.18
144 0.19
145 0.19
146 0.21
147 0.2
148 0.25
149 0.23
150 0.23
151 0.19
152 0.19
153 0.19
154 0.17
155 0.17
156 0.12
157 0.11
158 0.1
159 0.09
160 0.08
161 0.14
162 0.22
163 0.23
164 0.3
165 0.32
166 0.35
167 0.37
168 0.37
169 0.32
170 0.28
171 0.29
172 0.25
173 0.25
174 0.22
175 0.23
176 0.26
177 0.24
178 0.22
179 0.18
180 0.18
181 0.16
182 0.17
183 0.13
184 0.12
185 0.11
186 0.12
187 0.16
188 0.2
189 0.29
190 0.36
191 0.46
192 0.55
193 0.65
194 0.74
195 0.8
196 0.87
197 0.88
198 0.92
199 0.93
200 0.94
201 0.96
202 0.96