Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EL92

Protein Details
Accession A0A5J5EL92    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-148KAKAEKAKKPTVTRRKKQSATSLPHydrophilic
NLS Segment(s)
PositionSequence
54-66AGKQKGKGKGGRQ
97-141EAEKAKKAKQRAEKKAEKVEKAEKAKAEKAKAEKAKKPTVTRRKK
175-179RKPSR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, mito_nucl 11.666, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAYAKAVVTDKLGDTKEAALVHRVLDVLGNQRDEFKASQDISIFEKEEIRARYAGKQKGKGKGGRQKLSEARCTDWAELEARELEAREQDRLAEEKEAEKAKKAKQRAEKKAEKVEKAEKAKAEKAKAEKAKKPTVTRRKKQSATSLPAQPEPTGDKGNNQQTPLAGSSRPLRTRKPSRRLGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.2
5 0.2
6 0.18
7 0.18
8 0.17
9 0.17
10 0.16
11 0.12
12 0.12
13 0.13
14 0.17
15 0.19
16 0.21
17 0.2
18 0.22
19 0.23
20 0.24
21 0.23
22 0.19
23 0.22
24 0.21
25 0.23
26 0.22
27 0.23
28 0.23
29 0.24
30 0.22
31 0.17
32 0.18
33 0.17
34 0.22
35 0.22
36 0.21
37 0.21
38 0.22
39 0.29
40 0.35
41 0.42
42 0.43
43 0.5
44 0.54
45 0.6
46 0.66
47 0.64
48 0.65
49 0.66
50 0.7
51 0.67
52 0.63
53 0.62
54 0.62
55 0.6
56 0.57
57 0.5
58 0.43
59 0.41
60 0.41
61 0.35
62 0.28
63 0.25
64 0.2
65 0.17
66 0.15
67 0.11
68 0.09
69 0.09
70 0.08
71 0.07
72 0.09
73 0.1
74 0.1
75 0.09
76 0.09
77 0.1
78 0.12
79 0.12
80 0.1
81 0.1
82 0.1
83 0.14
84 0.17
85 0.16
86 0.19
87 0.23
88 0.28
89 0.34
90 0.38
91 0.42
92 0.49
93 0.6
94 0.66
95 0.71
96 0.73
97 0.73
98 0.78
99 0.77
100 0.69
101 0.64
102 0.61
103 0.6
104 0.57
105 0.54
106 0.47
107 0.46
108 0.5
109 0.5
110 0.45
111 0.43
112 0.43
113 0.48
114 0.54
115 0.56
116 0.57
117 0.59
118 0.65
119 0.66
120 0.7
121 0.71
122 0.74
123 0.77
124 0.8
125 0.83
126 0.84
127 0.83
128 0.81
129 0.81
130 0.8
131 0.76
132 0.73
133 0.69
134 0.61
135 0.59
136 0.54
137 0.43
138 0.35
139 0.32
140 0.29
141 0.27
142 0.25
143 0.27
144 0.33
145 0.42
146 0.43
147 0.41
148 0.38
149 0.34
150 0.37
151 0.35
152 0.29
153 0.2
154 0.2
155 0.26
156 0.33
157 0.41
158 0.42
159 0.47
160 0.55
161 0.66
162 0.74
163 0.77
164 0.79