Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5FBV5

Protein Details
Accession A0A5J5FBV5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77KTGPSKPAHKHEHKKEEAKPBasic
NLS Segment(s)
PositionSequence
67-72KHEHKK
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFARTAFRRAVAAAVRTSAPCRRYAQTHANHPQGGSSDLPWIIGSVAFTVPAAWYLVKTGPSKPAHKHEHKKEEAKPEPEPEPIKEEVKEAVAEVPQKAEEVKEKAEEKVEEVKEKGEEKFEEAKEAVSERKEEEEPKSSTVNPQKIDPGNTATKEAGGPGTISGKQEGLSNDDTSHAILHEERGDAISKKAEGVHDTAKLKGTVDVDRPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.28
5 0.29
6 0.26
7 0.28
8 0.31
9 0.33
10 0.37
11 0.44
12 0.5
13 0.51
14 0.6
15 0.64
16 0.65
17 0.62
18 0.57
19 0.5
20 0.42
21 0.37
22 0.27
23 0.19
24 0.17
25 0.16
26 0.16
27 0.14
28 0.13
29 0.1
30 0.09
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.08
43 0.09
44 0.13
45 0.15
46 0.16
47 0.24
48 0.29
49 0.34
50 0.38
51 0.45
52 0.51
53 0.6
54 0.68
55 0.7
56 0.76
57 0.78
58 0.81
59 0.78
60 0.79
61 0.76
62 0.7
63 0.63
64 0.56
65 0.51
66 0.48
67 0.44
68 0.34
69 0.31
70 0.29
71 0.28
72 0.24
73 0.23
74 0.19
75 0.17
76 0.16
77 0.12
78 0.1
79 0.1
80 0.11
81 0.1
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.11
89 0.12
90 0.15
91 0.16
92 0.17
93 0.19
94 0.19
95 0.18
96 0.23
97 0.23
98 0.21
99 0.21
100 0.21
101 0.21
102 0.22
103 0.2
104 0.16
105 0.15
106 0.18
107 0.24
108 0.23
109 0.24
110 0.22
111 0.22
112 0.19
113 0.2
114 0.18
115 0.12
116 0.13
117 0.12
118 0.15
119 0.16
120 0.18
121 0.2
122 0.25
123 0.26
124 0.27
125 0.28
126 0.25
127 0.32
128 0.38
129 0.39
130 0.34
131 0.34
132 0.38
133 0.38
134 0.41
135 0.35
136 0.32
137 0.31
138 0.31
139 0.32
140 0.25
141 0.23
142 0.21
143 0.19
144 0.14
145 0.1
146 0.09
147 0.08
148 0.11
149 0.11
150 0.12
151 0.12
152 0.12
153 0.12
154 0.15
155 0.15
156 0.17
157 0.19
158 0.19
159 0.18
160 0.19
161 0.19
162 0.16
163 0.16
164 0.11
165 0.1
166 0.1
167 0.12
168 0.12
169 0.12
170 0.12
171 0.13
172 0.16
173 0.15
174 0.17
175 0.18
176 0.16
177 0.17
178 0.19
179 0.2
180 0.2
181 0.24
182 0.26
183 0.3
184 0.31
185 0.32
186 0.33
187 0.31
188 0.29
189 0.28
190 0.27
191 0.26
192 0.29