Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F8E8

Protein Details
Accession A0A5J5F8E8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-39NNNNNNNNNKNNKNNKNNHNHNPQPQPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLIHTHHHNNSNNNNNNNNNNKNNKNNKNNHNHNPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPPQLPTITIIRLPRKSNLARLIRDRLGGWSSENHHPLAVSLVTGFAALGRFRFGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.69
4 0.69
5 0.67
6 0.65
7 0.66
8 0.67
9 0.71
10 0.76
11 0.78
12 0.79
13 0.81
14 0.83
15 0.85
16 0.87
17 0.86
18 0.85
19 0.83
20 0.8
21 0.79
22 0.76
23 0.74
24 0.71
25 0.68
26 0.65
27 0.66
28 0.64
29 0.65
30 0.64
31 0.65
32 0.65
33 0.68
34 0.67
35 0.68
36 0.68
37 0.68
38 0.68
39 0.68
40 0.68
41 0.68
42 0.68
43 0.68
44 0.68
45 0.68
46 0.68
47 0.68
48 0.68
49 0.67
50 0.66
51 0.65
52 0.63
53 0.6
54 0.55
55 0.5
56 0.44
57 0.37
58 0.33
59 0.28
60 0.24
61 0.2
62 0.24
63 0.25
64 0.29
65 0.3
66 0.31
67 0.36
68 0.37
69 0.41
70 0.45
71 0.46
72 0.47
73 0.51
74 0.55
75 0.49
76 0.48
77 0.41
78 0.35
79 0.3
80 0.26
81 0.21
82 0.19
83 0.22
84 0.28
85 0.29
86 0.26
87 0.25
88 0.24
89 0.23
90 0.21
91 0.17
92 0.11
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.05
99 0.07
100 0.07
101 0.08