Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5F5N5

Protein Details
Accession A0A5J5F5N5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAAAQGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
9-24GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 9, nucl 8, mito 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAQGGKKQKKKWSKGKVKDKAQHAVVMDKTIQERLNKDVLTYRLITTAVLVDRLKINGSLARKALADLEEKGVIKKIVGHHKLNIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.82
4 0.84
5 0.88
6 0.93
7 0.93
8 0.92
9 0.89
10 0.85
11 0.81
12 0.72
13 0.65
14 0.55
15 0.5
16 0.39
17 0.34
18 0.27
19 0.21
20 0.2
21 0.19
22 0.2
23 0.17
24 0.18
25 0.2
26 0.24
27 0.22
28 0.22
29 0.23
30 0.22
31 0.22
32 0.22
33 0.19
34 0.15
35 0.15
36 0.14
37 0.1
38 0.1
39 0.08
40 0.09
41 0.09
42 0.08
43 0.09
44 0.1
45 0.1
46 0.08
47 0.09
48 0.11
49 0.13
50 0.15
51 0.15
52 0.16
53 0.15
54 0.16
55 0.16
56 0.14
57 0.15
58 0.13
59 0.15
60 0.17
61 0.17
62 0.17
63 0.18
64 0.16
65 0.14
66 0.17
67 0.22
68 0.3
69 0.36
70 0.39
71 0.42
72 0.49
73 0.55
74 0.56
75 0.53
76 0.46
77 0.41
78 0.38