Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5F3Q5

Protein Details
Accession A0A5J5F3Q5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-34GSCCWLLRGKKKKNESPGLRHydrophilic
NLS Segment(s)
PositionSequence
23-44GKKKKNESPGLRGLISRSKAGG
Subcellular Location(s) mito 22, extr 3
Family & Domain DBs
Amino Acid Sequences MLFRCMAVTAATPQGSCCWLLRGKKKKNESPGLRGLISRSKAGGRAGRDTSTSTYILPGQARNTNTLAREGCYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.14
6 0.19
7 0.27
8 0.36
9 0.46
10 0.54
11 0.62
12 0.7
13 0.74
14 0.78
15 0.81
16 0.77
17 0.74
18 0.71
19 0.66
20 0.57
21 0.5
22 0.42
23 0.36
24 0.31
25 0.24
26 0.18
27 0.15
28 0.17
29 0.2
30 0.22
31 0.19
32 0.23
33 0.25
34 0.25
35 0.25
36 0.26
37 0.26
38 0.24
39 0.22
40 0.17
41 0.17
42 0.17
43 0.19
44 0.18
45 0.18
46 0.19
47 0.24
48 0.25
49 0.27
50 0.29
51 0.29
52 0.29
53 0.33
54 0.3