Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VFG1

Protein Details
Accession H1VFG1   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-124EAERVEHKRKDDKKGSKESGEKSBasic
NLS Segment(s)
PositionSequence
109-122KRKDDKKGSKESGE
Subcellular Location(s) nucl 15.5, mito_nucl 11, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MGGYLWFLYISKDLSYKAALNITVSKRQQALYQERGFDPATWEALVQEANSLRREIRFVATEYDVDWDETKDLGGEEVQEVLDKEKKGSRRRQDDDEDDAEEAERVEHKRKDDKKGSKESGEKSEDKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.18
5 0.19
6 0.18
7 0.19
8 0.25
9 0.27
10 0.32
11 0.32
12 0.32
13 0.31
14 0.32
15 0.34
16 0.35
17 0.39
18 0.4
19 0.43
20 0.42
21 0.41
22 0.43
23 0.4
24 0.32
25 0.27
26 0.19
27 0.18
28 0.15
29 0.14
30 0.11
31 0.11
32 0.11
33 0.07
34 0.08
35 0.08
36 0.1
37 0.11
38 0.12
39 0.11
40 0.12
41 0.13
42 0.13
43 0.14
44 0.14
45 0.14
46 0.16
47 0.16
48 0.16
49 0.15
50 0.14
51 0.12
52 0.11
53 0.1
54 0.08
55 0.07
56 0.07
57 0.07
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.11
70 0.11
71 0.13
72 0.17
73 0.25
74 0.33
75 0.43
76 0.51
77 0.58
78 0.63
79 0.69
80 0.73
81 0.71
82 0.69
83 0.61
84 0.53
85 0.42
86 0.37
87 0.29
88 0.21
89 0.16
90 0.1
91 0.11
92 0.12
93 0.19
94 0.23
95 0.28
96 0.38
97 0.45
98 0.55
99 0.63
100 0.7
101 0.73
102 0.8
103 0.82
104 0.8
105 0.81
106 0.76
107 0.74
108 0.7
109 0.66
110 0.6