Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VEY2

Protein Details
Accession H1VEY2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-87SPGRNVFQDEKKKKRTQPKQRAFDHydrophilic
NLS Segment(s)
PositionSequence
74-79KKKKRT
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MLWLYIRRRRRHAAAAAAAALERQSVPYTPTKGQAQAQARDMTHAHKGSADIQPGPTSPSLDESPGRNVFQDEKKKKRTQPKQRAFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.53
4 0.45
5 0.37
6 0.28
7 0.21
8 0.12
9 0.07
10 0.06
11 0.06
12 0.07
13 0.1
14 0.14
15 0.19
16 0.2
17 0.24
18 0.25
19 0.27
20 0.28
21 0.33
22 0.34
23 0.32
24 0.34
25 0.33
26 0.31
27 0.3
28 0.28
29 0.22
30 0.21
31 0.19
32 0.16
33 0.14
34 0.15
35 0.16
36 0.19
37 0.18
38 0.14
39 0.15
40 0.15
41 0.15
42 0.16
43 0.13
44 0.11
45 0.1
46 0.13
47 0.13
48 0.15
49 0.17
50 0.17
51 0.24
52 0.26
53 0.26
54 0.22
55 0.24
56 0.28
57 0.35
58 0.44
59 0.48
60 0.55
61 0.64
62 0.72
63 0.79
64 0.84
65 0.86
66 0.87
67 0.88