Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F611

Protein Details
Accession A0A5J5F611    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-70NWKSKQKLFNEKRPGRPRKLBasic
107-139QRYLRQMGLKTRRRKKPKIRRVWIRRRTKEGGSBasic
NLS Segment(s)
PositionSequence
62-69KRPGRPRK
116-136KTRRRKKPKIRRVWIRRRTKE
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13565  HTH_32  
Amino Acid Sequences MPIDKATGKRRESTIEERVEVIAKRAAGKTFTEIAQETGVSRAESQRIWANWKSKQKLFNEKRPGRPRKLTETERQQLKKLAEEDPDASIAELTRRMGGKVSRVTVQRYLRQMGLKTRRRKKPKIRRVWIRRRTKEGGSVIVPKGSGLKFEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.5
4 0.46
5 0.44
6 0.41
7 0.34
8 0.29
9 0.22
10 0.18
11 0.2
12 0.21
13 0.21
14 0.2
15 0.21
16 0.23
17 0.23
18 0.22
19 0.22
20 0.2
21 0.2
22 0.19
23 0.17
24 0.13
25 0.12
26 0.13
27 0.1
28 0.1
29 0.11
30 0.12
31 0.12
32 0.14
33 0.18
34 0.19
35 0.24
36 0.28
37 0.32
38 0.37
39 0.47
40 0.5
41 0.48
42 0.54
43 0.55
44 0.61
45 0.64
46 0.66
47 0.68
48 0.7
49 0.76
50 0.79
51 0.81
52 0.77
53 0.78
54 0.73
55 0.71
56 0.73
57 0.68
58 0.65
59 0.67
60 0.66
61 0.65
62 0.62
63 0.54
64 0.5
65 0.45
66 0.41
67 0.34
68 0.3
69 0.24
70 0.24
71 0.24
72 0.2
73 0.19
74 0.15
75 0.13
76 0.1
77 0.08
78 0.07
79 0.07
80 0.06
81 0.08
82 0.09
83 0.09
84 0.12
85 0.13
86 0.18
87 0.21
88 0.23
89 0.25
90 0.27
91 0.3
92 0.35
93 0.39
94 0.39
95 0.39
96 0.39
97 0.38
98 0.4
99 0.39
100 0.42
101 0.47
102 0.51
103 0.57
104 0.65
105 0.72
106 0.78
107 0.86
108 0.88
109 0.89
110 0.91
111 0.92
112 0.93
113 0.94
114 0.95
115 0.96
116 0.95
117 0.95
118 0.92
119 0.89
120 0.84
121 0.77
122 0.75
123 0.68
124 0.63
125 0.57
126 0.55
127 0.47
128 0.43
129 0.38
130 0.29
131 0.3
132 0.24
133 0.22