Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EXW0

Protein Details
Accession A0A5J5EXW0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-127GEEAVKSKEPKPKKKKVEGEGEGEBasic
NLS Segment(s)
PositionSequence
109-119KSKEPKPKKKK
Subcellular Location(s) mito 22, cyto_mito 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR020592  Ribosomal_S16_CS  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MVIRLRLARFGKRRAPVYNIVVTHARTARGSKPLEVIGTYDPIAKPPPEDVGGKPIKDIQLDTARAKYWLGVGAQPSDPVWRLLSMYGLIEPQWTVARIKAAAGEEAVKSKEPKPKKKKVEGEGEGEGEGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.62
4 0.6
5 0.58
6 0.5
7 0.46
8 0.43
9 0.39
10 0.37
11 0.31
12 0.27
13 0.21
14 0.24
15 0.25
16 0.3
17 0.31
18 0.28
19 0.29
20 0.29
21 0.28
22 0.25
23 0.23
24 0.17
25 0.17
26 0.15
27 0.15
28 0.13
29 0.13
30 0.15
31 0.13
32 0.13
33 0.12
34 0.14
35 0.14
36 0.16
37 0.16
38 0.22
39 0.25
40 0.24
41 0.23
42 0.23
43 0.22
44 0.2
45 0.2
46 0.16
47 0.19
48 0.22
49 0.22
50 0.21
51 0.2
52 0.2
53 0.2
54 0.15
55 0.1
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.12
62 0.12
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.08
69 0.09
70 0.08
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.12
85 0.11
86 0.12
87 0.14
88 0.14
89 0.13
90 0.13
91 0.14
92 0.12
93 0.15
94 0.16
95 0.15
96 0.17
97 0.22
98 0.3
99 0.39
100 0.49
101 0.58
102 0.67
103 0.76
104 0.84
105 0.89
106 0.89
107 0.9
108 0.84
109 0.8
110 0.73
111 0.64
112 0.53