Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EBW9

Protein Details
Accession A0A5J5EBW9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-92SGQSDDVKKHKRKPKRKRKPKRKRKSKMPIENDNPRNBasic
NLS Segment(s)
PositionSequence
63-83KKHKRKPKRKRKPKRKRKSKM
Subcellular Location(s) cyto 6.5, cyto_nucl 8, mito 11, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006311  TAT_signal  
PROSITE View protein in PROSITE  
PS51318  TAT  
Amino Acid Sequences MTAFIRRFILGRAAAAAAPDAAVATPAADAPEDAAVVTPTADGETSQATVPSIPASGQSDDVKKHKRKPKRKRKPKRKRKSKMPIENDNPRNVPKLKTDTSASDSVCLPASAVQGNIRSINVDVPNYQGVDVAWNLNANGIVSAVSFSFGGSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.09
5 0.08
6 0.07
7 0.06
8 0.04
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.05
21 0.06
22 0.05
23 0.05
24 0.06
25 0.05
26 0.04
27 0.05
28 0.05
29 0.04
30 0.05
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.05
41 0.07
42 0.09
43 0.1
44 0.12
45 0.14
46 0.15
47 0.18
48 0.24
49 0.32
50 0.36
51 0.44
52 0.51
53 0.6
54 0.69
55 0.78
56 0.83
57 0.85
58 0.91
59 0.93
60 0.96
61 0.97
62 0.97
63 0.97
64 0.97
65 0.96
66 0.96
67 0.96
68 0.95
69 0.94
70 0.91
71 0.89
72 0.85
73 0.85
74 0.76
75 0.69
76 0.59
77 0.5
78 0.46
79 0.38
80 0.33
81 0.28
82 0.32
83 0.31
84 0.32
85 0.33
86 0.32
87 0.35
88 0.36
89 0.31
90 0.25
91 0.23
92 0.21
93 0.19
94 0.16
95 0.11
96 0.09
97 0.1
98 0.09
99 0.1
100 0.11
101 0.12
102 0.14
103 0.14
104 0.13
105 0.12
106 0.12
107 0.16
108 0.16
109 0.16
110 0.15
111 0.17
112 0.18
113 0.18
114 0.17
115 0.13
116 0.11
117 0.12
118 0.13
119 0.11
120 0.1
121 0.1
122 0.1
123 0.11
124 0.11
125 0.09
126 0.08
127 0.07
128 0.06
129 0.06
130 0.07
131 0.06
132 0.07
133 0.06
134 0.06