Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EDJ1

Protein Details
Accession A0A5J5EDJ1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
137-158PVVGTTAPRRKRGRPRKAQALQHydrophilic
NLS Segment(s)
PositionSequence
144-154PRRKRGRPRKA
Subcellular Location(s) mito 13, cyto 9, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSMENSATANKYVHPSLAGIASAVPESAAQKKRGRPAKTTLRGAGEDTMVATTRQATCNSEAAATRRNPGRLRKPSMTAAPTISLAALHGHAPRAELPSLIVVLKVRTVGAGVAGDISGAVVSEQMEATAVATGTVPVVGTTAPRRKRGRPRKAQALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.18
5 0.15
6 0.11
7 0.1
8 0.1
9 0.09
10 0.08
11 0.06
12 0.06
13 0.08
14 0.16
15 0.21
16 0.26
17 0.32
18 0.38
19 0.47
20 0.55
21 0.58
22 0.55
23 0.6
24 0.66
25 0.68
26 0.68
27 0.63
28 0.58
29 0.54
30 0.5
31 0.42
32 0.31
33 0.22
34 0.17
35 0.13
36 0.1
37 0.09
38 0.07
39 0.08
40 0.09
41 0.11
42 0.12
43 0.14
44 0.16
45 0.17
46 0.18
47 0.17
48 0.16
49 0.17
50 0.21
51 0.2
52 0.22
53 0.23
54 0.27
55 0.3
56 0.37
57 0.45
58 0.48
59 0.54
60 0.53
61 0.54
62 0.53
63 0.53
64 0.47
65 0.37
66 0.3
67 0.23
68 0.2
69 0.16
70 0.13
71 0.08
72 0.07
73 0.06
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.11
82 0.11
83 0.1
84 0.1
85 0.1
86 0.1
87 0.09
88 0.09
89 0.06
90 0.07
91 0.07
92 0.07
93 0.06
94 0.05
95 0.06
96 0.05
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.02
108 0.03
109 0.03
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.05
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.08
128 0.16
129 0.25
130 0.31
131 0.4
132 0.47
133 0.56
134 0.68
135 0.76
136 0.79
137 0.81
138 0.86