Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F624

Protein Details
Accession A0A5J5F624   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39DNRNEDHRVNRLRKRYQQNRRSAWQKYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5.5, cyto_nucl 10.5, mito 3, nucl 14.5, pero 2
Family & Domain DBs
Amino Acid Sequences MNSELMIVPKTRDNRNEDHRVNRLRKRYQQNRRSAWQKYSTRLTVIHQCSTPGGRRPSSTLRRDDGATTHVTGGTVDRTQVLAYHKHTIITAEHSSEATAAIDVCETRLMCPLDEEEHMVHAGDFAHPVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.65
4 0.64
5 0.67
6 0.69
7 0.72
8 0.75
9 0.75
10 0.75
11 0.74
12 0.78
13 0.81
14 0.83
15 0.85
16 0.85
17 0.88
18 0.85
19 0.84
20 0.82
21 0.76
22 0.73
23 0.71
24 0.67
25 0.62
26 0.61
27 0.54
28 0.48
29 0.44
30 0.41
31 0.4
32 0.39
33 0.35
34 0.29
35 0.28
36 0.27
37 0.28
38 0.28
39 0.26
40 0.26
41 0.25
42 0.26
43 0.3
44 0.38
45 0.44
46 0.46
47 0.44
48 0.41
49 0.41
50 0.41
51 0.37
52 0.29
53 0.22
54 0.18
55 0.14
56 0.12
57 0.11
58 0.1
59 0.09
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.1
68 0.11
69 0.14
70 0.16
71 0.21
72 0.21
73 0.21
74 0.22
75 0.21
76 0.2
77 0.21
78 0.2
79 0.16
80 0.17
81 0.16
82 0.16
83 0.14
84 0.13
85 0.08
86 0.07
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.08
93 0.08
94 0.08
95 0.14
96 0.15
97 0.15
98 0.17
99 0.18
100 0.19
101 0.2
102 0.22
103 0.16
104 0.17
105 0.17
106 0.16
107 0.13
108 0.11
109 0.11
110 0.09
111 0.09