Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EE78

Protein Details
Accession A0A5J5EE78    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-93AASGQSKDAKKRKRKVKPQTPTSKSMHydrophilic
NLS Segment(s)
PositionSequence
74-85KDAKKRKRKVKP
Subcellular Location(s) nucl 15, cyto_nucl 12, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MAAFLRSVSKGRTLAADDADASGAIPETPPLQQDLAGTTEPAGVYLPLPLYRALRDNQPILPSPPTTAASGQSKDAKKRKRKVKPQTPTSKSMLRHHQQKPIDQEKKAQNDNPRKVRWLTDETSDSDGPAGTPEPVSASALHENPGSVLANVFGCPGMDIAPNITPSGTGSRITFIFCGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.21
5 0.2
6 0.19
7 0.15
8 0.12
9 0.09
10 0.07
11 0.06
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.1
18 0.1
19 0.11
20 0.11
21 0.13
22 0.14
23 0.14
24 0.13
25 0.11
26 0.12
27 0.11
28 0.11
29 0.09
30 0.06
31 0.06
32 0.07
33 0.08
34 0.07
35 0.08
36 0.1
37 0.11
38 0.12
39 0.15
40 0.15
41 0.2
42 0.23
43 0.24
44 0.25
45 0.26
46 0.27
47 0.26
48 0.27
49 0.22
50 0.2
51 0.2
52 0.19
53 0.18
54 0.17
55 0.18
56 0.19
57 0.2
58 0.21
59 0.25
60 0.27
61 0.34
62 0.41
63 0.47
64 0.53
65 0.62
66 0.7
67 0.74
68 0.82
69 0.85
70 0.88
71 0.89
72 0.89
73 0.91
74 0.85
75 0.79
76 0.72
77 0.67
78 0.59
79 0.55
80 0.53
81 0.48
82 0.53
83 0.52
84 0.56
85 0.53
86 0.54
87 0.57
88 0.59
89 0.59
90 0.5
91 0.54
92 0.53
93 0.57
94 0.55
95 0.51
96 0.5
97 0.55
98 0.63
99 0.64
100 0.58
101 0.56
102 0.54
103 0.53
104 0.49
105 0.45
106 0.38
107 0.35
108 0.35
109 0.34
110 0.37
111 0.33
112 0.27
113 0.2
114 0.18
115 0.13
116 0.12
117 0.1
118 0.06
119 0.06
120 0.06
121 0.08
122 0.09
123 0.1
124 0.09
125 0.12
126 0.15
127 0.16
128 0.17
129 0.15
130 0.14
131 0.14
132 0.15
133 0.12
134 0.09
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.07
141 0.06
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.1
148 0.12
149 0.13
150 0.13
151 0.13
152 0.12
153 0.13
154 0.17
155 0.16
156 0.16
157 0.16
158 0.19
159 0.19
160 0.21
161 0.19