Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5ENA0

Protein Details
Accession A0A5J5ENA0    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
11-67SAAASHRYNLRKRRRCDEVQPPVAAKKTKTLPAAEKKLRPKRDARRRIRPDTTSPPSHydrophilic
248-272PLRQMKRARVWKNPLKKVKKPLFGLHydrophilic
NLS Segment(s)
PositionSequence
35-59AKKTKTLPAAEKKLRPKRDARRRIR
254-267RARVWKNPLKKVKK
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MPLNPFRTRSSAAASHRYNLRKRRRCDEVQPPVAAKKTKTLPAAEKKLRPKRDARRRIRPDTTSPPSLNHHASTCRCSPPSPISTVAAAPSPPPSSPSSISTSITTSLPPSSTFASTATSPAPSESRKALPSPPPASDIDPWPTFLPAIEDRDEPIAVTTIPFLTDFSCTFVRELQSNDTAAVLVVSMPDATQRILKLFLPEPNAWIDPFSAEYSAYCSLVHHGVSLPPSTSARRVVPYCYGAVNIQPLRQMKRARVWKNPLKKVKKPLFGLLLEFIPDAPSILNAPERLARRPELVADVLAALGMVHSAGVLHQDDMPRNILIDGNDGVWWIDFGCALTTAYNKIHPNWFQGERRRVKELLTNDVIPAELEGRVPTWRTLGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.56
4 0.61
5 0.63
6 0.66
7 0.71
8 0.71
9 0.76
10 0.79
11 0.8
12 0.8
13 0.82
14 0.83
15 0.82
16 0.8
17 0.77
18 0.71
19 0.66
20 0.64
21 0.57
22 0.47
23 0.44
24 0.43
25 0.45
26 0.47
27 0.49
28 0.53
29 0.59
30 0.68
31 0.68
32 0.7
33 0.75
34 0.8
35 0.82
36 0.79
37 0.79
38 0.8
39 0.83
40 0.86
41 0.86
42 0.87
43 0.89
44 0.91
45 0.9
46 0.85
47 0.82
48 0.81
49 0.78
50 0.74
51 0.65
52 0.59
53 0.55
54 0.54
55 0.49
56 0.41
57 0.37
58 0.37
59 0.39
60 0.41
61 0.41
62 0.41
63 0.39
64 0.38
65 0.4
66 0.41
67 0.42
68 0.4
69 0.38
70 0.34
71 0.33
72 0.33
73 0.28
74 0.21
75 0.17
76 0.14
77 0.14
78 0.14
79 0.13
80 0.15
81 0.16
82 0.2
83 0.22
84 0.25
85 0.27
86 0.28
87 0.29
88 0.28
89 0.27
90 0.24
91 0.22
92 0.19
93 0.15
94 0.13
95 0.13
96 0.12
97 0.13
98 0.13
99 0.14
100 0.14
101 0.13
102 0.14
103 0.14
104 0.15
105 0.14
106 0.12
107 0.11
108 0.12
109 0.15
110 0.14
111 0.16
112 0.18
113 0.2
114 0.21
115 0.23
116 0.28
117 0.32
118 0.39
119 0.4
120 0.38
121 0.38
122 0.37
123 0.38
124 0.34
125 0.3
126 0.27
127 0.24
128 0.24
129 0.21
130 0.2
131 0.17
132 0.15
133 0.16
134 0.13
135 0.16
136 0.16
137 0.16
138 0.16
139 0.18
140 0.18
141 0.13
142 0.11
143 0.09
144 0.07
145 0.07
146 0.06
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.1
155 0.11
156 0.11
157 0.12
158 0.13
159 0.14
160 0.14
161 0.15
162 0.15
163 0.15
164 0.15
165 0.15
166 0.13
167 0.12
168 0.1
169 0.08
170 0.05
171 0.03
172 0.03
173 0.03
174 0.03
175 0.02
176 0.03
177 0.04
178 0.04
179 0.05
180 0.06
181 0.07
182 0.08
183 0.09
184 0.12
185 0.13
186 0.16
187 0.19
188 0.19
189 0.2
190 0.21
191 0.21
192 0.17
193 0.16
194 0.13
195 0.08
196 0.1
197 0.09
198 0.07
199 0.07
200 0.07
201 0.1
202 0.1
203 0.1
204 0.09
205 0.08
206 0.1
207 0.11
208 0.11
209 0.08
210 0.08
211 0.09
212 0.1
213 0.11
214 0.1
215 0.09
216 0.11
217 0.12
218 0.14
219 0.16
220 0.16
221 0.2
222 0.21
223 0.22
224 0.24
225 0.25
226 0.24
227 0.21
228 0.2
229 0.16
230 0.16
231 0.2
232 0.17
233 0.16
234 0.19
235 0.22
236 0.25
237 0.31
238 0.33
239 0.32
240 0.4
241 0.5
242 0.52
243 0.59
244 0.64
245 0.67
246 0.75
247 0.8
248 0.81
249 0.8
250 0.81
251 0.82
252 0.82
253 0.81
254 0.74
255 0.7
256 0.66
257 0.58
258 0.52
259 0.43
260 0.34
261 0.27
262 0.23
263 0.17
264 0.11
265 0.1
266 0.08
267 0.06
268 0.06
269 0.06
270 0.07
271 0.09
272 0.09
273 0.1
274 0.15
275 0.18
276 0.21
277 0.24
278 0.25
279 0.26
280 0.26
281 0.27
282 0.25
283 0.24
284 0.2
285 0.17
286 0.15
287 0.12
288 0.1
289 0.08
290 0.05
291 0.03
292 0.03
293 0.02
294 0.02
295 0.02
296 0.02
297 0.02
298 0.05
299 0.06
300 0.07
301 0.1
302 0.13
303 0.15
304 0.17
305 0.2
306 0.17
307 0.17
308 0.17
309 0.17
310 0.14
311 0.16
312 0.14
313 0.13
314 0.13
315 0.12
316 0.12
317 0.1
318 0.09
319 0.06
320 0.06
321 0.05
322 0.06
323 0.07
324 0.07
325 0.08
326 0.09
327 0.1
328 0.14
329 0.15
330 0.21
331 0.22
332 0.25
333 0.33
334 0.34
335 0.39
336 0.42
337 0.48
338 0.51
339 0.59
340 0.66
341 0.67
342 0.7
343 0.7
344 0.63
345 0.59
346 0.58
347 0.53
348 0.52
349 0.48
350 0.44
351 0.39
352 0.38
353 0.34
354 0.27
355 0.22
356 0.14
357 0.1
358 0.09
359 0.1
360 0.11
361 0.13
362 0.15
363 0.16