Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EWU4

Protein Details
Accession A0A5J5EWU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-29SRTSECGSKARKRRENKAGGRVGHydrophilic
NLS Segment(s)
PositionSequence
16-23ARKRRENK
Subcellular Location(s) plas 14, mito 6, E.R. 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRYRESRTSECGSKARKRRENKAGGRVGIYFSMTMTLSVCVCKFEFAPLAFRPQIRVGTQCMPVSKCVLRIVLAVFFFSSNVLQNARCLRMFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.67
4 0.7
5 0.74
6 0.79
7 0.82
8 0.85
9 0.84
10 0.84
11 0.8
12 0.72
13 0.65
14 0.55
15 0.46
16 0.36
17 0.27
18 0.17
19 0.1
20 0.1
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.11
34 0.11
35 0.15
36 0.14
37 0.19
38 0.19
39 0.19
40 0.2
41 0.19
42 0.22
43 0.19
44 0.2
45 0.19
46 0.22
47 0.25
48 0.25
49 0.25
50 0.24
51 0.24
52 0.26
53 0.23
54 0.22
55 0.21
56 0.2
57 0.18
58 0.18
59 0.19
60 0.18
61 0.17
62 0.15
63 0.13
64 0.12
65 0.12
66 0.11
67 0.11
68 0.09
69 0.11
70 0.13
71 0.13
72 0.18
73 0.23
74 0.26
75 0.26