Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5ECL0

Protein Details
Accession A0A5J5ECL0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-112EEYLLKLERERRRRERKNEERDSVIBasic
NLS Segment(s)
PositionSequence
97-104ERRRRERK
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027532  Mdm12  
IPR031468  SMP_LBD  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0032865  C:ERMES complex  
GO:0008289  F:lipid binding  
GO:0006869  P:lipid transport  
GO:0000002  P:mitochondrial genome maintenance  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
PROSITE View protein in PROSITE  
PS51847  SMP  
CDD cd21672  SMP_Mdm12  
Amino Acid Sequences MSVDLNWDALTSGPEGQARAEKIRSFIHDKFQLVPFPKFIKSVQVHSFSFGTIAPDIELKTICDPYPEFYEQDEEDGSESDSGDEHDEEYLLKLERERRRRERKNEERDSVISRSSTQPPPYSEGNGNRLSGFRAGIADAFPGRVGVTGVTTPLFTPQPPSGSGNASNLHYFHSALSFSNGSSTPVRAAFPSASTPATPSKLQTYTTTASNGSFPSPPSPAGPDSGPVPELAELALKERDSPTRTFGGESESLPRPRLREPRDEDTQIIARVRYAGNVRVEITCELLFEYPVTNFVALPVKLVITGCTFDGLACVAYIRRRAHFCFLDEDPDTQDRQSTYGRSLLKQINVESEIGEKGKGKQVLKNVGKVERFVLEQVRRIFEEEFVFPSSWTFLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.22
5 0.24
6 0.27
7 0.3
8 0.3
9 0.32
10 0.37
11 0.41
12 0.43
13 0.44
14 0.48
15 0.49
16 0.49
17 0.5
18 0.49
19 0.5
20 0.47
21 0.46
22 0.42
23 0.4
24 0.4
25 0.38
26 0.35
27 0.37
28 0.36
29 0.41
30 0.43
31 0.45
32 0.43
33 0.44
34 0.44
35 0.34
36 0.31
37 0.24
38 0.2
39 0.14
40 0.14
41 0.11
42 0.12
43 0.12
44 0.13
45 0.13
46 0.12
47 0.14
48 0.16
49 0.16
50 0.18
51 0.18
52 0.2
53 0.26
54 0.27
55 0.25
56 0.24
57 0.28
58 0.25
59 0.26
60 0.23
61 0.16
62 0.15
63 0.14
64 0.14
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.09
73 0.08
74 0.09
75 0.09
76 0.1
77 0.11
78 0.1
79 0.1
80 0.14
81 0.22
82 0.31
83 0.4
84 0.5
85 0.58
86 0.69
87 0.79
88 0.86
89 0.88
90 0.9
91 0.92
92 0.92
93 0.85
94 0.79
95 0.72
96 0.66
97 0.57
98 0.48
99 0.37
100 0.3
101 0.3
102 0.31
103 0.33
104 0.31
105 0.33
106 0.34
107 0.38
108 0.38
109 0.37
110 0.37
111 0.37
112 0.39
113 0.37
114 0.35
115 0.31
116 0.29
117 0.27
118 0.22
119 0.17
120 0.11
121 0.1
122 0.09
123 0.09
124 0.09
125 0.08
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.08
141 0.09
142 0.08
143 0.11
144 0.12
145 0.14
146 0.16
147 0.18
148 0.17
149 0.2
150 0.21
151 0.2
152 0.2
153 0.19
154 0.18
155 0.16
156 0.16
157 0.14
158 0.13
159 0.1
160 0.1
161 0.1
162 0.09
163 0.11
164 0.09
165 0.08
166 0.1
167 0.1
168 0.11
169 0.11
170 0.11
171 0.11
172 0.11
173 0.12
174 0.1
175 0.12
176 0.1
177 0.1
178 0.11
179 0.11
180 0.11
181 0.1
182 0.12
183 0.12
184 0.14
185 0.14
186 0.13
187 0.16
188 0.17
189 0.18
190 0.18
191 0.21
192 0.2
193 0.21
194 0.21
195 0.17
196 0.17
197 0.17
198 0.15
199 0.12
200 0.11
201 0.11
202 0.12
203 0.12
204 0.13
205 0.12
206 0.15
207 0.14
208 0.15
209 0.14
210 0.13
211 0.13
212 0.13
213 0.12
214 0.09
215 0.09
216 0.08
217 0.07
218 0.07
219 0.06
220 0.06
221 0.08
222 0.09
223 0.08
224 0.09
225 0.1
226 0.15
227 0.17
228 0.18
229 0.2
230 0.22
231 0.22
232 0.22
233 0.21
234 0.22
235 0.2
236 0.2
237 0.21
238 0.23
239 0.24
240 0.25
241 0.26
242 0.23
243 0.3
244 0.38
245 0.39
246 0.44
247 0.5
248 0.55
249 0.6
250 0.6
251 0.53
252 0.48
253 0.45
254 0.37
255 0.31
256 0.24
257 0.18
258 0.18
259 0.17
260 0.16
261 0.16
262 0.19
263 0.2
264 0.21
265 0.22
266 0.2
267 0.22
268 0.19
269 0.2
270 0.14
271 0.12
272 0.12
273 0.11
274 0.11
275 0.09
276 0.1
277 0.07
278 0.09
279 0.09
280 0.08
281 0.08
282 0.1
283 0.15
284 0.14
285 0.15
286 0.14
287 0.13
288 0.14
289 0.14
290 0.13
291 0.09
292 0.1
293 0.09
294 0.1
295 0.1
296 0.09
297 0.09
298 0.08
299 0.07
300 0.06
301 0.06
302 0.07
303 0.1
304 0.18
305 0.2
306 0.25
307 0.3
308 0.33
309 0.41
310 0.43
311 0.42
312 0.41
313 0.39
314 0.41
315 0.37
316 0.35
317 0.31
318 0.3
319 0.29
320 0.23
321 0.25
322 0.19
323 0.21
324 0.23
325 0.21
326 0.22
327 0.27
328 0.3
329 0.29
330 0.36
331 0.38
332 0.39
333 0.4
334 0.39
335 0.38
336 0.37
337 0.35
338 0.28
339 0.25
340 0.22
341 0.2
342 0.2
343 0.16
344 0.18
345 0.25
346 0.31
347 0.31
348 0.34
349 0.42
350 0.52
351 0.55
352 0.59
353 0.57
354 0.59
355 0.58
356 0.55
357 0.49
358 0.4
359 0.37
360 0.33
361 0.36
362 0.32
363 0.38
364 0.4
365 0.42
366 0.4
367 0.42
368 0.39
369 0.34
370 0.34
371 0.29
372 0.27
373 0.26
374 0.26
375 0.23
376 0.23