Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5FAD6

Protein Details
Accession A0A5J5FAD6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-86YTLNTYKLTTNERRRRRRRRRRBasic
NLS Segment(s)
PositionSequence
77-86RRRRRRRRRR
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 4.5, plas 3
Family & Domain DBs
Amino Acid Sequences MTLAQLQALVIWSPTLSTLILHINVPRQPCMHCSVLVTLASGRLQMNYGQVSCHMKRSFVVQVPYTLNTYKLTTNERRRRRRRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.1
7 0.11
8 0.12
9 0.12
10 0.15
11 0.18
12 0.19
13 0.19
14 0.18
15 0.18
16 0.2
17 0.24
18 0.22
19 0.2
20 0.19
21 0.19
22 0.19
23 0.18
24 0.16
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.06
31 0.07
32 0.07
33 0.09
34 0.09
35 0.09
36 0.08
37 0.1
38 0.16
39 0.16
40 0.23
41 0.22
42 0.21
43 0.21
44 0.26
45 0.3
46 0.29
47 0.33
48 0.26
49 0.3
50 0.32
51 0.33
52 0.31
53 0.25
54 0.22
55 0.2
56 0.21
57 0.2
58 0.21
59 0.27
60 0.35
61 0.46
62 0.55
63 0.64
64 0.73
65 0.82
66 0.9