Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EWI0

Protein Details
Accession A0A5J5EWI0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-117DPSHRVRKRRSGFLVRLKTRTGRATLKRRKLKGRKSLSHBasic
NLS Segment(s)
PositionSequence
83-115RVRKRRSGFLVRLKTRTGRATLKRRKLKGRKSL
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFALRTAFWTSRPAAARAFSTLLSTSTMRRPTVLGAAPAGLATPPTTVLGATDTIVPKVSASPVLQALQVRNGPRDTFDPSHRVRKRRSGFLVRLKTRTGRATLKRRKLKGRKSLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.27
5 0.27
6 0.2
7 0.2
8 0.18
9 0.16
10 0.17
11 0.16
12 0.16
13 0.2
14 0.24
15 0.22
16 0.22
17 0.22
18 0.21
19 0.26
20 0.25
21 0.19
22 0.16
23 0.16
24 0.15
25 0.14
26 0.12
27 0.07
28 0.05
29 0.05
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.11
55 0.13
56 0.15
57 0.15
58 0.16
59 0.17
60 0.16
61 0.17
62 0.19
63 0.22
64 0.23
65 0.26
66 0.3
67 0.33
68 0.44
69 0.48
70 0.53
71 0.53
72 0.6
73 0.63
74 0.66
75 0.71
76 0.7
77 0.73
78 0.77
79 0.81
80 0.76
81 0.73
82 0.66
83 0.62
84 0.57
85 0.52
86 0.48
87 0.47
88 0.51
89 0.59
90 0.67
91 0.73
92 0.78
93 0.82
94 0.87
95 0.88
96 0.89
97 0.88