FuNGI

A0A5J5F3T6

Protein Details

Accession

A0A5J5F3T6

Localization Confidence

Low

Confidence Score

8.9

NoLS Segment(s)

Position	Sequence	Protein Nature
19-42	TELMPPPPLKRIKRPPKVLDEDSY	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR019148 Nuclear_protein_DGCR14_ESS-2
Gene Ontology	GO:0005634 C:nucleus
Pfam	View protein in Pfam PF09751 Es2

Amino Acid Sequences

MASTTAGASSALIRKPTDTELMPPPPLKRIKRPPKVLDEDSYTDALSEIIARDFFPGLYETKYQQEYLDAIESQDSEWIEDASRKLTEVMTTPQHRRRGTSFQTPQFRDSSATPALGSTPVLGSATPAKISGEKEKKKMDTSLSLDAFQSKYTSEDNESFNTLLDKQNEKRRNAYAFLWNGNRIPGFRTQAHQKRLKAQAEAQEEGPQKLLVAPDDRPAIPNTWKAEPRNSLMFIPDTSSPPPEKSDLPPKSVVYANTRMPPPSAVPPERPASPSASLIADAIAGRPRPPESEADFGFRNVETPRVNGYSFVDAAPSPSPESLGAPPLTWGSVAAVSDTAPAPSPFKIAATPKRELLHHRMVEKVAKGKRTTNRPGTPKTPGMSGGRMTTQGGGGKGREIPKFGSSPALTPAGQRLWGNLTGRGEAGLRESILKGTSTPKAGGRGFRWDPTPRADGK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.27
3	0.3
4	0.3
5	0.26
6	0.29
7	0.34
8	0.39
9	0.42
10	0.43
11	0.41
12	0.45
13	0.52
14	0.54
15	0.57
16	0.62
17	0.69
18	0.76
19	0.85
20	0.85
21	0.86
22	0.88
23	0.83
24	0.78
25	0.73
26	0.67
27	0.6
28	0.52
29	0.41
30	0.32
31	0.26
32	0.2
33	0.13
34	0.1
35	0.08
36	0.08
37	0.09
38	0.09
39	0.1
40	0.11
41	0.11
42	0.11
43	0.12
44	0.12
45	0.15
46	0.18
47	0.18
48	0.23
49	0.25
50	0.24
51	0.23
52	0.24
53	0.21
54	0.21
55	0.22
56	0.17
57	0.15
58	0.16
59	0.16
60	0.13
61	0.15
62	0.12
63	0.1
64	0.1
65	0.11
66	0.11
67	0.13
68	0.14
69	0.14
70	0.14
71	0.14
72	0.14
73	0.14
74	0.15
75	0.15
76	0.2
77	0.25
78	0.31
79	0.39
80	0.45
81	0.53
82	0.52
83	0.54
84	0.55
85	0.56
86	0.57
87	0.6
88	0.62
89	0.62
90	0.71
91	0.69
92	0.66
93	0.58
94	0.52
95	0.44
96	0.36
97	0.33
98	0.25
99	0.23
100	0.2
101	0.18
102	0.18
103	0.16
104	0.14
105	0.09
106	0.07
107	0.07
108	0.07
109	0.07
110	0.07
111	0.1
112	0.11
113	0.11
114	0.11
115	0.11
116	0.14
117	0.17
118	0.26
119	0.33
120	0.38
121	0.44
122	0.5
123	0.53
124	0.53
125	0.55
126	0.49
127	0.47
128	0.46
129	0.48
130	0.42
131	0.4
132	0.37
133	0.34
134	0.3
135	0.22
136	0.18
137	0.1
138	0.11
139	0.11
140	0.13
141	0.15
142	0.18
143	0.2
144	0.21
145	0.22
146	0.2
147	0.19
148	0.18
149	0.16
150	0.17
151	0.18
152	0.22
153	0.26
154	0.36
155	0.43
156	0.44
157	0.47
158	0.49
159	0.49
160	0.46
161	0.44
162	0.42
163	0.38
164	0.4
165	0.37
166	0.33
167	0.3
168	0.28
169	0.25
170	0.18
171	0.17
172	0.17
173	0.19
174	0.19
175	0.22
176	0.31
177	0.38
178	0.46
179	0.51
180	0.48
181	0.52
182	0.59
183	0.59
184	0.51
185	0.48
186	0.48
187	0.46
188	0.45
189	0.37
190	0.35
191	0.33
192	0.31
193	0.27
194	0.19
195	0.14
196	0.14
197	0.14
198	0.08
199	0.09
200	0.1
201	0.12
202	0.14
203	0.14
204	0.14
205	0.15
206	0.16
207	0.16
208	0.2
209	0.2
210	0.22
211	0.26
212	0.27
213	0.31
214	0.31
215	0.32
216	0.3
217	0.29
218	0.25
219	0.22
220	0.21
221	0.16
222	0.15
223	0.14
224	0.13
225	0.12
226	0.14
227	0.14
228	0.14
229	0.16
230	0.16
231	0.17
232	0.19
233	0.29
234	0.29
235	0.32
236	0.33
237	0.32
238	0.32
239	0.32
240	0.31
241	0.26
242	0.28
243	0.26
244	0.28
245	0.28
246	0.26
247	0.25
248	0.24
249	0.2
250	0.22
251	0.26
252	0.25
253	0.27
254	0.3
255	0.32
256	0.32
257	0.31
258	0.26
259	0.24
260	0.23
261	0.21
262	0.18
263	0.16
264	0.15
265	0.14
266	0.12
267	0.08
268	0.07
269	0.07
270	0.08
271	0.08
272	0.08
273	0.1
274	0.11
275	0.12
276	0.14
277	0.18
278	0.2
279	0.25
280	0.25
281	0.27
282	0.27
283	0.25
284	0.25
285	0.2
286	0.17
287	0.13
288	0.16
289	0.13
290	0.14
291	0.18
292	0.19
293	0.19
294	0.18
295	0.2
296	0.18
297	0.18
298	0.17
299	0.14
300	0.12
301	0.14
302	0.14
303	0.13
304	0.11
305	0.1
306	0.11
307	0.11
308	0.13
309	0.12
310	0.15
311	0.15
312	0.13
313	0.14
314	0.14
315	0.13
316	0.11
317	0.1
318	0.07
319	0.08
320	0.08
321	0.07
322	0.07
323	0.07
324	0.08
325	0.08
326	0.08
327	0.08
328	0.09
329	0.1
330	0.1
331	0.12
332	0.11
333	0.12
334	0.16
335	0.23
336	0.31
337	0.35
338	0.37
339	0.4
340	0.42
341	0.44
342	0.46
343	0.46
344	0.48
345	0.46
346	0.45
347	0.44
348	0.44
349	0.47
350	0.44
351	0.44
352	0.39
353	0.41
354	0.42
355	0.47
356	0.52
357	0.58
358	0.64
359	0.66
360	0.7
361	0.72
362	0.76
363	0.74
364	0.73
365	0.69
366	0.61
367	0.52
368	0.48
369	0.44
370	0.4
371	0.36
372	0.31
373	0.27
374	0.26
375	0.25
376	0.21
377	0.2
378	0.19
379	0.18
380	0.18
381	0.17
382	0.18
383	0.23
384	0.27
385	0.27
386	0.27
387	0.28
388	0.3
389	0.32
390	0.3
391	0.33
392	0.29
393	0.29
394	0.3
395	0.3
396	0.26
397	0.25
398	0.3
399	0.24
400	0.26
401	0.24
402	0.23
403	0.23
404	0.28
405	0.29
406	0.28
407	0.28
408	0.27
409	0.27
410	0.25
411	0.21
412	0.17
413	0.18
414	0.15
415	0.14
416	0.14
417	0.15
418	0.16
419	0.16
420	0.16
421	0.15
422	0.18
423	0.23
424	0.24
425	0.26
426	0.28
427	0.34
428	0.38
429	0.44
430	0.42
431	0.47
432	0.48
433	0.49
434	0.52
435	0.51
436	0.51
437	0.5

A0A5J5F3T6

3D AlphaFold-predicted Structure Viewer