Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F7V8

Protein Details
Accession A0A5J5F7V8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-217RSVSPRRRNMSPPPRRRNRDDSPPRWRDRDSRDYRRRARDDSPPPRRRBasic
NLS Segment(s)
PositionSequence
167-218ARRRSVSPRRRNMSPPPRRRNRDDSPPRWRDRDSRDYRRRARDDSPPPRRRD
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSSNVGLSTPRGSGTSGYVQRNMSLLKPRRQEAPLNADETKKYRQRAPDAEILAHDRKREVEVKCLELQDKLEEEELPEEEIETRVQALREKLLAEVDGSSKIDARGLKPHQVHELAAAKMVESERLRNALGISKDYEEGSHWRRQEEEKIRRMEQREQGNSGSTSARRRSVSPRRRNMSPPPRRRNRDDSPPRWRDRDSRDYRRRARDDSPPPRRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.3
4 0.33
5 0.35
6 0.35
7 0.35
8 0.36
9 0.33
10 0.28
11 0.32
12 0.37
13 0.41
14 0.47
15 0.48
16 0.52
17 0.55
18 0.58
19 0.55
20 0.56
21 0.52
22 0.51
23 0.5
24 0.46
25 0.44
26 0.41
27 0.42
28 0.38
29 0.38
30 0.39
31 0.46
32 0.53
33 0.58
34 0.59
35 0.58
36 0.54
37 0.51
38 0.47
39 0.45
40 0.41
41 0.35
42 0.3
43 0.24
44 0.22
45 0.26
46 0.31
47 0.26
48 0.3
49 0.32
50 0.36
51 0.37
52 0.38
53 0.35
54 0.29
55 0.29
56 0.22
57 0.2
58 0.16
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.1
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.06
71 0.06
72 0.07
73 0.08
74 0.1
75 0.1
76 0.11
77 0.12
78 0.12
79 0.12
80 0.11
81 0.11
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.07
90 0.09
91 0.09
92 0.1
93 0.17
94 0.19
95 0.25
96 0.26
97 0.28
98 0.28
99 0.28
100 0.27
101 0.23
102 0.25
103 0.19
104 0.19
105 0.17
106 0.13
107 0.13
108 0.13
109 0.13
110 0.1
111 0.12
112 0.12
113 0.13
114 0.14
115 0.13
116 0.14
117 0.14
118 0.15
119 0.15
120 0.15
121 0.15
122 0.15
123 0.15
124 0.15
125 0.12
126 0.17
127 0.19
128 0.23
129 0.23
130 0.23
131 0.25
132 0.29
133 0.37
134 0.42
135 0.47
136 0.5
137 0.54
138 0.57
139 0.61
140 0.62
141 0.6
142 0.57
143 0.57
144 0.54
145 0.51
146 0.49
147 0.46
148 0.42
149 0.35
150 0.31
151 0.24
152 0.26
153 0.27
154 0.31
155 0.3
156 0.33
157 0.42
158 0.5
159 0.58
160 0.62
161 0.69
162 0.7
163 0.74
164 0.77
165 0.78
166 0.78
167 0.78
168 0.79
169 0.8
170 0.84
171 0.86
172 0.88
173 0.86
174 0.83
175 0.84
176 0.84
177 0.83
178 0.83
179 0.85
180 0.83
181 0.79
182 0.75
183 0.73
184 0.71
185 0.72
186 0.72
187 0.73
188 0.77
189 0.83
190 0.87
191 0.89
192 0.87
193 0.82
194 0.78
195 0.78
196 0.79
197 0.79
198 0.81