Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EUZ6

Protein Details
Accession A0A5J5EUZ6   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-71PSPALRRPLRARPRVSRRARRPASLPHydrophilic
NLS Segment(s)
PositionSequence
48-73PALRRPLRARPRVSRRARRPASLPSR
Subcellular Location(s) cyto 3, extr 2, mito 8, nucl 12, plas 2
Family & Domain DBs
Amino Acid Sequences MLPASPMMCLPMTALSGISRLALCRLPLRLPRYRSRCPSPTAQPPPSPALRRPLRARPRVSRRARRPASLPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.07
7 0.07
8 0.09
9 0.1
10 0.1
11 0.12
12 0.14
13 0.18
14 0.24
15 0.29
16 0.34
17 0.38
18 0.46
19 0.52
20 0.57
21 0.59
22 0.6
23 0.58
24 0.54
25 0.56
26 0.53
27 0.56
28 0.57
29 0.55
30 0.5
31 0.49
32 0.5
33 0.5
34 0.47
35 0.39
36 0.4
37 0.41
38 0.46
39 0.5
40 0.56
41 0.61
42 0.66
43 0.71
44 0.72
45 0.77
46 0.81
47 0.85
48 0.86
49 0.86
50 0.89
51 0.86
52 0.82
53 0.77