Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EWW7

Protein Details
Accession A0A5J5EWW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
303-328GQMAIWAKKKERRYRKEFGSAYKKKCHydrophilic
NLS Segment(s)
PositionSequence
310-318KKKERRYRK
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR039357  SRD5A/TECR  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
Amino Acid Sequences MITLNVKPRSYPLKNLPETVQIDLATTTVEDLYNILSKATGLNRNRLRITKGSDGSVVSTKRDDGKLVTVEETGLRDGSQIFVKDLGPQIAWRTVFMVEYLGPLIIHPLVLFVLRPYIYSASKWNPLSYLPFSPSIDGPLPPPTTTQLVMCLLIILHFLKREYETVFVHRFSAATMPAFNIFKNSAHYWILSGLNLAYFLYAPTSSPAASWWPRFLDAESNPAVRYGVIALWISSELANYSTHVTLRNLRPSDGSTKRQIPRGFGFNLVTCPNYLFETTAWLAIVILSGGNWASVLFLVVAAGQMAIWAKKKERRYRKEFGSAYKKKCAMFPGFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.61
4 0.59
5 0.57
6 0.5
7 0.43
8 0.32
9 0.29
10 0.26
11 0.22
12 0.14
13 0.11
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.09
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.14
26 0.19
27 0.26
28 0.26
29 0.36
30 0.42
31 0.48
32 0.53
33 0.53
34 0.53
35 0.51
36 0.54
37 0.54
38 0.5
39 0.46
40 0.44
41 0.4
42 0.38
43 0.37
44 0.31
45 0.24
46 0.23
47 0.22
48 0.25
49 0.26
50 0.24
51 0.21
52 0.26
53 0.27
54 0.27
55 0.27
56 0.22
57 0.21
58 0.21
59 0.2
60 0.14
61 0.11
62 0.09
63 0.09
64 0.09
65 0.1
66 0.12
67 0.11
68 0.11
69 0.12
70 0.13
71 0.15
72 0.16
73 0.16
74 0.13
75 0.14
76 0.15
77 0.18
78 0.18
79 0.16
80 0.15
81 0.15
82 0.14
83 0.14
84 0.12
85 0.08
86 0.09
87 0.09
88 0.07
89 0.07
90 0.06
91 0.07
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.04
100 0.07
101 0.07
102 0.07
103 0.09
104 0.11
105 0.12
106 0.13
107 0.18
108 0.19
109 0.26
110 0.26
111 0.24
112 0.23
113 0.23
114 0.26
115 0.25
116 0.23
117 0.19
118 0.21
119 0.21
120 0.21
121 0.2
122 0.19
123 0.16
124 0.14
125 0.14
126 0.16
127 0.17
128 0.16
129 0.17
130 0.15
131 0.16
132 0.16
133 0.15
134 0.13
135 0.12
136 0.12
137 0.11
138 0.09
139 0.07
140 0.07
141 0.07
142 0.05
143 0.05
144 0.05
145 0.06
146 0.07
147 0.08
148 0.09
149 0.09
150 0.12
151 0.12
152 0.17
153 0.18
154 0.18
155 0.18
156 0.16
157 0.15
158 0.12
159 0.13
160 0.09
161 0.07
162 0.07
163 0.07
164 0.09
165 0.1
166 0.09
167 0.1
168 0.1
169 0.1
170 0.14
171 0.14
172 0.15
173 0.15
174 0.16
175 0.14
176 0.15
177 0.15
178 0.11
179 0.11
180 0.08
181 0.07
182 0.07
183 0.06
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.12
196 0.15
197 0.17
198 0.18
199 0.18
200 0.2
201 0.2
202 0.2
203 0.22
204 0.2
205 0.23
206 0.23
207 0.22
208 0.21
209 0.21
210 0.2
211 0.12
212 0.12
213 0.08
214 0.06
215 0.07
216 0.07
217 0.07
218 0.07
219 0.07
220 0.07
221 0.06
222 0.06
223 0.05
224 0.06
225 0.07
226 0.07
227 0.09
228 0.1
229 0.1
230 0.13
231 0.14
232 0.21
233 0.27
234 0.35
235 0.34
236 0.34
237 0.35
238 0.36
239 0.43
240 0.43
241 0.42
242 0.4
243 0.48
244 0.51
245 0.56
246 0.55
247 0.52
248 0.5
249 0.51
250 0.46
251 0.4
252 0.39
253 0.33
254 0.34
255 0.29
256 0.25
257 0.19
258 0.18
259 0.16
260 0.15
261 0.15
262 0.13
263 0.11
264 0.16
265 0.16
266 0.16
267 0.15
268 0.13
269 0.12
270 0.11
271 0.11
272 0.05
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.05
283 0.04
284 0.04
285 0.05
286 0.05
287 0.05
288 0.04
289 0.04
290 0.03
291 0.04
292 0.06
293 0.08
294 0.13
295 0.16
296 0.23
297 0.31
298 0.42
299 0.52
300 0.62
301 0.7
302 0.75
303 0.82
304 0.84
305 0.87
306 0.83
307 0.83
308 0.83
309 0.82
310 0.8
311 0.79
312 0.74
313 0.65
314 0.63
315 0.6