Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F7Q3

Protein Details
Accession A0A5J5F7Q3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-126GQASKIEKPSRQQRKQRKNKQKTLRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
100-132IEKPSRQQRKQRKNKQKTLRGTAKVKGAKKKKE
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTVTLRTRKFMRNALLARKQMVVDVLHAGKPNISKDDLRTKLAELYKSEKDCVSVFGLRTQFGGGKTTGFALIYDSVESLKKFEPHYRLVRYGQASKIEKPSRQQRKQRKNKQKTLRGTAKVKGAKKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.64
4 0.67
5 0.62
6 0.58
7 0.52
8 0.45
9 0.36
10 0.33
11 0.23
12 0.16
13 0.18
14 0.18
15 0.17
16 0.18
17 0.17
18 0.17
19 0.18
20 0.19
21 0.18
22 0.19
23 0.19
24 0.23
25 0.33
26 0.34
27 0.35
28 0.33
29 0.31
30 0.35
31 0.37
32 0.34
33 0.27
34 0.29
35 0.33
36 0.33
37 0.33
38 0.27
39 0.26
40 0.23
41 0.22
42 0.2
43 0.16
44 0.15
45 0.19
46 0.19
47 0.17
48 0.17
49 0.16
50 0.14
51 0.12
52 0.14
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.1
70 0.12
71 0.15
72 0.21
73 0.25
74 0.31
75 0.38
76 0.41
77 0.43
78 0.43
79 0.46
80 0.45
81 0.44
82 0.41
83 0.42
84 0.4
85 0.4
86 0.47
87 0.47
88 0.45
89 0.5
90 0.57
91 0.6
92 0.67
93 0.74
94 0.76
95 0.82
96 0.9
97 0.93
98 0.94
99 0.94
100 0.95
101 0.95
102 0.94
103 0.93
104 0.92
105 0.91
106 0.88
107 0.83
108 0.77
109 0.76
110 0.74
111 0.71
112 0.71