Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F0I0

Protein Details
Accession A0A5J5F0I0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-84QLFWPCTWRRVRRWQKEKIRCRPHRRLPPCRCSQRRCLYRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, plas 8, mito 4
Family & Domain DBs
Amino Acid Sequences MSPSQTARRAIAIVSAAVGIPACLLLADVTCVYCGCRLGDPPLEQLFWPCTWRRVRRWQKEKIRCRPHRRLPPCRCSQRRCLYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.09
5 0.08
6 0.05
7 0.04
8 0.04
9 0.03
10 0.02
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.07
22 0.07
23 0.08
24 0.09
25 0.12
26 0.16
27 0.16
28 0.19
29 0.19
30 0.19
31 0.18
32 0.18
33 0.17
34 0.13
35 0.15
36 0.13
37 0.18
38 0.26
39 0.33
40 0.39
41 0.48
42 0.59
43 0.67
44 0.76
45 0.8
46 0.83
47 0.88
48 0.91
49 0.91
50 0.91
51 0.91
52 0.92
53 0.92
54 0.92
55 0.92
56 0.92
57 0.92
58 0.92
59 0.91
60 0.92
61 0.92
62 0.91
63 0.87
64 0.87