Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5FA69

Protein Details
Accession A0A5J5FA69    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPSRPRSNPSRKKRERRRLQAQAQALAHydrophilic
45-72SPSGSCSRNNPSRKKRARRRLQAQAEALHydrophilic
NLS Segment(s)
PositionSequence
5-18PRSNPSRKKRERRR
56-64SRKKRARRR
Subcellular Location(s) mito 14, nucl 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPSRPRSNPSRKKRERRRLQAQAQALASSLQLPPPQSLPPPPSSSPSGSCSRNNPSRKKRARRRLQAQAEALASSLQLPSPQSEPASNKPCIALPPPSITTSPSPLPRVPSPLRRAPSPPPRVLSPLPREPLVEATLPEPPIESFMSCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.96
4 0.95
5 0.95
6 0.93
7 0.91
8 0.84
9 0.78
10 0.68
11 0.57
12 0.46
13 0.35
14 0.26
15 0.18
16 0.13
17 0.1
18 0.11
19 0.12
20 0.13
21 0.14
22 0.16
23 0.17
24 0.22
25 0.24
26 0.27
27 0.31
28 0.31
29 0.33
30 0.35
31 0.36
32 0.34
33 0.34
34 0.34
35 0.32
36 0.33
37 0.35
38 0.39
39 0.45
40 0.5
41 0.56
42 0.61
43 0.68
44 0.76
45 0.82
46 0.85
47 0.88
48 0.9
49 0.91
50 0.9
51 0.9
52 0.88
53 0.83
54 0.74
55 0.65
56 0.54
57 0.43
58 0.34
59 0.23
60 0.14
61 0.08
62 0.06
63 0.04
64 0.04
65 0.05
66 0.06
67 0.07
68 0.08
69 0.09
70 0.12
71 0.16
72 0.23
73 0.28
74 0.27
75 0.26
76 0.26
77 0.26
78 0.25
79 0.24
80 0.21
81 0.18
82 0.22
83 0.23
84 0.24
85 0.24
86 0.24
87 0.23
88 0.23
89 0.24
90 0.24
91 0.26
92 0.26
93 0.31
94 0.3
95 0.36
96 0.38
97 0.43
98 0.46
99 0.5
100 0.52
101 0.5
102 0.53
103 0.55
104 0.6
105 0.6
106 0.58
107 0.54
108 0.54
109 0.57
110 0.57
111 0.56
112 0.54
113 0.53
114 0.51
115 0.48
116 0.47
117 0.42
118 0.41
119 0.34
120 0.28
121 0.2
122 0.19
123 0.22
124 0.21
125 0.2
126 0.17
127 0.14
128 0.16
129 0.17