Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EMG0

Protein Details
Accession A0A5J5EMG0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-123YNNTSGGRRKTWKRHNTLQVHRYRHydrophilic
NLS Segment(s)
PositionSequence
78-97RGKTSAGKKYRGVGKGHGKG
107-109RRK
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024794  Rbsml_L15e_core_dom_sf  
IPR000439  Ribosomal_L15e  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00827  Ribosomal_L15e  
Amino Acid Sequences MFSFVNQLKPEKSRQAVAEERVGRRCRNLRVLNSYWVNQDACWKYFEVILVDPFHKAIRRDPRMNWICYPQQKRRECRGKTSAGKKYRGVGKGHGKGHLYNNTSGGRRKTWKRHNTLQVHRYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.5
4 0.49
5 0.51
6 0.48
7 0.49
8 0.52
9 0.53
10 0.46
11 0.48
12 0.51
13 0.5
14 0.54
15 0.57
16 0.56
17 0.61
18 0.63
19 0.62
20 0.59
21 0.53
22 0.44
23 0.39
24 0.32
25 0.24
26 0.29
27 0.24
28 0.22
29 0.22
30 0.21
31 0.19
32 0.19
33 0.2
34 0.14
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.12
41 0.12
42 0.13
43 0.13
44 0.18
45 0.27
46 0.34
47 0.37
48 0.38
49 0.48
50 0.5
51 0.52
52 0.46
53 0.41
54 0.4
55 0.45
56 0.51
57 0.48
58 0.53
59 0.58
60 0.64
61 0.7
62 0.74
63 0.68
64 0.7
65 0.69
66 0.69
67 0.7
68 0.73
69 0.71
70 0.69
71 0.7
72 0.63
73 0.62
74 0.61
75 0.57
76 0.5
77 0.49
78 0.52
79 0.56
80 0.56
81 0.54
82 0.48
83 0.46
84 0.51
85 0.5
86 0.43
87 0.36
88 0.39
89 0.38
90 0.4
91 0.42
92 0.39
93 0.38
94 0.44
95 0.52
96 0.59
97 0.66
98 0.73
99 0.76
100 0.83
101 0.86
102 0.88
103 0.89