Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F9U8

Protein Details
Accession A0A5J5F9U8   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
95-128HHLRRRCRSHFHARRDRRGRGRGRRRRGERPGARBasic
178-198RGARVRRHRGGGRCRRRRGGCBasic
NLS Segment(s)
PositionSequence
99-136RRCRSHFHARRDRRGRGRGRRRRGERPGARLRRARHRS
171-196RGGGPHGRGARVRRHRGGGRCRRRRG
213-218RRAGHR
Subcellular Location(s) cyto 10, extr 8, mito 7
Family & Domain DBs
Amino Acid Sequences MVRTSEQGEAIALGIAMLCQSPHGTPAAGRAPANIATRLGVVHVVGLHDVHLVVGDRRGAILVPDIYAVPFAAGHPVGVAAGVARECSLGGAGSHHLRRRCRSHFHARRDRRGRGRGRRRRGERPGARLRRARHRSGAVHGVAAHGVFQAAVITFLRRSRSGLDGFAAAERGGGPHGRGARVRRHRGGGRCRRRRGGCGLGEHESSCGRARLRRAGHRPGPGPVFHPRPPVIRAVFLPATVPEELAAALFDWWMSTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.06
8 0.06
9 0.08
10 0.1
11 0.1
12 0.1
13 0.17
14 0.22
15 0.23
16 0.23
17 0.22
18 0.24
19 0.29
20 0.31
21 0.26
22 0.21
23 0.19
24 0.19
25 0.18
26 0.16
27 0.11
28 0.08
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.09
43 0.08
44 0.08
45 0.09
46 0.08
47 0.07
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.05
57 0.05
58 0.05
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.07
80 0.11
81 0.15
82 0.19
83 0.23
84 0.28
85 0.34
86 0.41
87 0.45
88 0.5
89 0.55
90 0.62
91 0.67
92 0.74
93 0.79
94 0.79
95 0.83
96 0.83
97 0.83
98 0.81
99 0.8
100 0.8
101 0.8
102 0.83
103 0.83
104 0.85
105 0.86
106 0.85
107 0.85
108 0.84
109 0.84
110 0.79
111 0.78
112 0.79
113 0.76
114 0.75
115 0.7
116 0.65
117 0.65
118 0.64
119 0.59
120 0.53
121 0.51
122 0.48
123 0.47
124 0.48
125 0.38
126 0.32
127 0.28
128 0.23
129 0.17
130 0.15
131 0.11
132 0.05
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.05
141 0.06
142 0.08
143 0.11
144 0.11
145 0.12
146 0.14
147 0.18
148 0.19
149 0.19
150 0.18
151 0.16
152 0.16
153 0.15
154 0.13
155 0.09
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.09
163 0.11
164 0.13
165 0.17
166 0.21
167 0.3
168 0.4
169 0.48
170 0.49
171 0.55
172 0.59
173 0.65
174 0.72
175 0.73
176 0.74
177 0.77
178 0.8
179 0.82
180 0.8
181 0.77
182 0.74
183 0.72
184 0.67
185 0.63
186 0.6
187 0.54
188 0.5
189 0.44
190 0.37
191 0.28
192 0.24
193 0.19
194 0.18
195 0.17
196 0.2
197 0.26
198 0.34
199 0.41
200 0.5
201 0.56
202 0.63
203 0.68
204 0.72
205 0.69
206 0.66
207 0.62
208 0.53
209 0.49
210 0.47
211 0.46
212 0.42
213 0.46
214 0.43
215 0.43
216 0.44
217 0.48
218 0.42
219 0.39
220 0.36
221 0.37
222 0.35
223 0.3
224 0.29
225 0.22
226 0.23
227 0.2
228 0.19
229 0.11
230 0.11
231 0.11
232 0.1
233 0.09
234 0.06
235 0.06
236 0.06
237 0.05