Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V6E6

Protein Details
Accession H1V6E6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
44-65EDNLKREIKKLQRQRDQIKTWAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012270  CCR4-NOT_su3/5  
IPR040168  Not2/3/5  
IPR007207  Not_N  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0051254  P:positive regulation of RNA metabolic process  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF04065  Not3  
Amino Acid Sequences MAARKLQQEVDKCFKKVAEGVAEFEAIYEKIEQSNNISQKEKLEDNLKREIKKLQRQRDQIKTWAASNDIKDKAPLLEHRRLIETQMEKFKAVEKAMKTKAYSKEGLASSAKLDPQEQAKAEASDFLNNMVDELEQQIETLEAEAEAIQATMKKGKTQTAKAERMAEIERIIERHKWHQGKLELIRRSLENGGVDTDQVTDLEETIRYYVSDGMNDDFVEDEEMYEELNLDEEEGVYGVPQDGDKGSSQETQSLAEEPTPEPEVIKPPPKPKAVADASASGRRSSAQSKSPLPALATLHTPLQTIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.43
4 0.41
5 0.4
6 0.35
7 0.37
8 0.35
9 0.35
10 0.31
11 0.27
12 0.22
13 0.13
14 0.12
15 0.1
16 0.1
17 0.13
18 0.14
19 0.15
20 0.2
21 0.28
22 0.33
23 0.35
24 0.37
25 0.35
26 0.38
27 0.42
28 0.38
29 0.34
30 0.39
31 0.4
32 0.43
33 0.52
34 0.54
35 0.5
36 0.51
37 0.55
38 0.55
39 0.6
40 0.66
41 0.66
42 0.7
43 0.78
44 0.85
45 0.86
46 0.81
47 0.77
48 0.75
49 0.66
50 0.59
51 0.51
52 0.45
53 0.39
54 0.37
55 0.37
56 0.32
57 0.3
58 0.28
59 0.27
60 0.24
61 0.25
62 0.29
63 0.3
64 0.35
65 0.37
66 0.39
67 0.41
68 0.4
69 0.38
70 0.37
71 0.33
72 0.31
73 0.36
74 0.36
75 0.33
76 0.33
77 0.35
78 0.32
79 0.3
80 0.3
81 0.26
82 0.34
83 0.38
84 0.41
85 0.38
86 0.41
87 0.46
88 0.45
89 0.43
90 0.36
91 0.38
92 0.34
93 0.36
94 0.3
95 0.24
96 0.2
97 0.2
98 0.2
99 0.14
100 0.14
101 0.13
102 0.15
103 0.18
104 0.16
105 0.18
106 0.18
107 0.18
108 0.18
109 0.19
110 0.17
111 0.15
112 0.15
113 0.12
114 0.12
115 0.11
116 0.11
117 0.08
118 0.07
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.08
139 0.08
140 0.11
141 0.12
142 0.18
143 0.23
144 0.27
145 0.37
146 0.42
147 0.46
148 0.46
149 0.48
150 0.43
151 0.4
152 0.37
153 0.28
154 0.19
155 0.16
156 0.14
157 0.12
158 0.13
159 0.14
160 0.14
161 0.19
162 0.27
163 0.29
164 0.31
165 0.37
166 0.38
167 0.43
168 0.48
169 0.51
170 0.45
171 0.43
172 0.43
173 0.36
174 0.36
175 0.29
176 0.23
177 0.16
178 0.13
179 0.14
180 0.13
181 0.12
182 0.1
183 0.1
184 0.08
185 0.07
186 0.07
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.06
195 0.07
196 0.1
197 0.1
198 0.11
199 0.12
200 0.12
201 0.13
202 0.13
203 0.12
204 0.09
205 0.08
206 0.09
207 0.08
208 0.07
209 0.07
210 0.07
211 0.07
212 0.06
213 0.06
214 0.04
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.04
224 0.04
225 0.04
226 0.05
227 0.04
228 0.05
229 0.06
230 0.08
231 0.09
232 0.1
233 0.13
234 0.16
235 0.17
236 0.19
237 0.2
238 0.2
239 0.2
240 0.2
241 0.18
242 0.16
243 0.17
244 0.15
245 0.18
246 0.18
247 0.17
248 0.16
249 0.17
250 0.22
251 0.27
252 0.35
253 0.38
254 0.44
255 0.51
256 0.54
257 0.56
258 0.53
259 0.56
260 0.53
261 0.51
262 0.46
263 0.45
264 0.46
265 0.48
266 0.46
267 0.36
268 0.31
269 0.28
270 0.29
271 0.29
272 0.3
273 0.32
274 0.38
275 0.43
276 0.46
277 0.48
278 0.46
279 0.42
280 0.4
281 0.35
282 0.31
283 0.29
284 0.27
285 0.26
286 0.24