Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V3J8

Protein Details
Accession H1V3J8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-101RDESTSRRRRVRCSKNRNRLFRSPSPFHydrophilic
NLS Segment(s)
PositionSequence
65-86RKPGPRKSRDRDESTSRRRRVR
Subcellular Location(s) mito 14.5, cyto_mito 9.833, nucl 6.5, cyto_nucl 5.833, cyto 4
Family & Domain DBs
Amino Acid Sequences LLSYFSSHRICYNLHMRASRTLSLASPWANPRRRPHTHSAAPGRCEESSPITGSLADLCAWETTRKPGPRKSRDRDESTSRRRRVRCSKNRNRLFRSPSPFAWNIHRIHSIDYQMRKQSVFTEFRFFGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.43
4 0.48
5 0.51
6 0.45
7 0.38
8 0.33
9 0.28
10 0.26
11 0.26
12 0.21
13 0.2
14 0.25
15 0.33
16 0.38
17 0.43
18 0.5
19 0.57
20 0.62
21 0.65
22 0.67
23 0.68
24 0.68
25 0.71
26 0.73
27 0.69
28 0.63
29 0.58
30 0.53
31 0.43
32 0.37
33 0.29
34 0.23
35 0.2
36 0.19
37 0.17
38 0.15
39 0.14
40 0.14
41 0.12
42 0.09
43 0.07
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.11
51 0.17
52 0.22
53 0.27
54 0.34
55 0.44
56 0.54
57 0.64
58 0.68
59 0.72
60 0.74
61 0.77
62 0.75
63 0.74
64 0.74
65 0.74
66 0.77
67 0.72
68 0.73
69 0.69
70 0.73
71 0.74
72 0.75
73 0.76
74 0.78
75 0.83
76 0.86
77 0.92
78 0.92
79 0.88
80 0.86
81 0.84
82 0.81
83 0.78
84 0.73
85 0.66
86 0.63
87 0.58
88 0.51
89 0.5
90 0.47
91 0.4
92 0.4
93 0.42
94 0.35
95 0.37
96 0.39
97 0.37
98 0.38
99 0.43
100 0.44
101 0.46
102 0.47
103 0.43
104 0.4
105 0.39
106 0.4
107 0.4
108 0.37
109 0.39