Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EH16

Protein Details
Accession A0A5J5EH16    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-58YALPKNPQKKAPERKRKTVCVDDDHydrophilic
NLS Segment(s)
PositionSequence
42-50QKKAPERKR
86-93KKAPERKR
149-166KPRVAKPRAAKPTVAKPK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 4, pero 3
Family & Domain DBs
Amino Acid Sequences MAHPFIMYPDTKKSAETAEKLPIAGDNITGGGNGYALPKNPQKKAPERKRKTVCVDDDDDKLRLDPASENTIGGANGYALPKDPQKKAPERKRKTVWVDDGDDDDTLHSDPADEDELAQTVDRPNGVVNKVDWDDIWQHYDFYSAAPAKPRVAKPRAAKPTVAKPKVAKQPQEHDGGNNDHTITKPTNKDTKIKIKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.39
4 0.36
5 0.38
6 0.38
7 0.38
8 0.36
9 0.29
10 0.24
11 0.2
12 0.16
13 0.1
14 0.1
15 0.1
16 0.09
17 0.08
18 0.06
19 0.06
20 0.06
21 0.08
22 0.09
23 0.1
24 0.15
25 0.22
26 0.29
27 0.33
28 0.39
29 0.45
30 0.54
31 0.65
32 0.71
33 0.75
34 0.77
35 0.83
36 0.85
37 0.86
38 0.84
39 0.81
40 0.76
41 0.71
42 0.68
43 0.6
44 0.55
45 0.49
46 0.42
47 0.32
48 0.27
49 0.21
50 0.16
51 0.14
52 0.12
53 0.13
54 0.17
55 0.16
56 0.16
57 0.16
58 0.16
59 0.15
60 0.12
61 0.09
62 0.05
63 0.06
64 0.07
65 0.06
66 0.06
67 0.08
68 0.12
69 0.17
70 0.2
71 0.24
72 0.32
73 0.42
74 0.52
75 0.61
76 0.68
77 0.71
78 0.78
79 0.78
80 0.79
81 0.76
82 0.73
83 0.68
84 0.61
85 0.56
86 0.47
87 0.43
88 0.35
89 0.28
90 0.2
91 0.13
92 0.1
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.06
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.1
113 0.12
114 0.12
115 0.12
116 0.16
117 0.16
118 0.16
119 0.15
120 0.14
121 0.16
122 0.16
123 0.19
124 0.15
125 0.15
126 0.14
127 0.16
128 0.13
129 0.11
130 0.15
131 0.13
132 0.14
133 0.19
134 0.21
135 0.23
136 0.3
137 0.35
138 0.39
139 0.42
140 0.48
141 0.51
142 0.6
143 0.66
144 0.62
145 0.61
146 0.57
147 0.64
148 0.67
149 0.63
150 0.57
151 0.52
152 0.59
153 0.65
154 0.67
155 0.64
156 0.61
157 0.67
158 0.66
159 0.68
160 0.6
161 0.52
162 0.5
163 0.46
164 0.4
165 0.33
166 0.29
167 0.24
168 0.23
169 0.25
170 0.24
171 0.27
172 0.32
173 0.38
174 0.46
175 0.49
176 0.57
177 0.62
178 0.69