Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F1K1

Protein Details
Accession A0A5J5F1K1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
102-122QTRNNRTVKGGKKKPSGGTKSHydrophilic
NLS Segment(s)
PositionSequence
110-119KGGKKKPSGG
Subcellular Location(s) mito 17, extr 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MSLLRVVAPRFTALSTPTTRLTAARFGSSDAGVPSKDELSPRSKESTRSATHDEIAHDDDAAYNPNRTNPEDEKHAAGREQGLHGAQNPLEFSGATPEVSHQTRNNRTVKGGKKKPSGGTKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.24
5 0.24
6 0.24
7 0.24
8 0.25
9 0.25
10 0.24
11 0.23
12 0.22
13 0.22
14 0.23
15 0.22
16 0.2
17 0.14
18 0.14
19 0.12
20 0.12
21 0.12
22 0.11
23 0.12
24 0.12
25 0.14
26 0.18
27 0.21
28 0.23
29 0.27
30 0.28
31 0.31
32 0.35
33 0.4
34 0.37
35 0.39
36 0.42
37 0.37
38 0.37
39 0.35
40 0.3
41 0.25
42 0.24
43 0.19
44 0.13
45 0.12
46 0.1
47 0.09
48 0.1
49 0.09
50 0.08
51 0.08
52 0.11
53 0.13
54 0.14
55 0.19
56 0.2
57 0.23
58 0.27
59 0.29
60 0.29
61 0.28
62 0.28
63 0.23
64 0.2
65 0.2
66 0.16
67 0.15
68 0.13
69 0.12
70 0.12
71 0.12
72 0.14
73 0.12
74 0.11
75 0.11
76 0.1
77 0.1
78 0.09
79 0.08
80 0.11
81 0.12
82 0.11
83 0.11
84 0.12
85 0.17
86 0.18
87 0.22
88 0.22
89 0.31
90 0.39
91 0.47
92 0.51
93 0.48
94 0.53
95 0.59
96 0.64
97 0.65
98 0.67
99 0.69
100 0.72
101 0.77
102 0.8
103 0.82